(data stored in ACNUC7421 zone)

EMBL: CP001622.PE105

CP001622.PE105       Location/Qualifiers
FT   CDS_pept        complement(100275..100724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0106"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000509 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54417"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ91"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000509"
FT                   /protein_id="ACS54417.1"
FT                   /translation="MNLGGRSAMRISCMGEKSVAVCVRRLLALISIVLGSAVQAFSCDQ
FT                   PIVISNWSFCALANVSEEGGDADWKVVPAWTREKAISAYFGNDPRLLANHGLCNAKFHH
FT                   VVLCQPGWQTGNPDECSYLVCSGYYSSLVGKEEREDYLRDHPTAQ"
     atgaatctcg ggggtagaag cgcgatgcga ataagctgta tgggggagaa gagcgtggcc        60
     gtttgcgtcc ggcgattgtt ggcattgatt tcgatcgtgc tgggaagcgc cgtccaggct       120
     ttttcctgcg atcagccgat tgtcatatcc aattggtcgt tctgtgcgct cgccaacgtg       180
     agcgaagagg gcggcgacgc tgattggaaa gtcgttcctg cctggactcg cgagaaagcc       240
     ataagcgcgt atttcggaaa cgatccgcgg ctcctagcaa accacggact ttgcaacgcc       300
     aaattccatc acgtcgtact ctgccagccg ggatggcaaa cgggcaaccc ggatgagtgc       360
     tcatatctgg tttgcagcgg ctattactca tctttggtcg ggaaggaaga aagggaagac       420
     tatttgagag accacccgac cgctcaatag                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page