(data stored in ACNUC7421 zone)

EMBL: CP001622.PE106

CP001622.PE106       Location/Qualifiers
FT   CDS_pept        100978..101565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0107"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000510 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54418"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ92"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000510"
FT                   /protein_id="ACS54418.1"
FT                   /translation="MAEFNPRDKSRTSQGKTRAMVRRHTAPPSGMDDGSLRWQWFTIQL
FT                   LESAAFTTLSANACRAFFRIVIEHTSHAALENGKLVVTHPQFVSYGVTGEYVADAIDEL
FT                   EYKGLIKVRRGRAGSGVAHPNRFTLTFVGDHEGAPPTDEWKRCTAERCRKWSETDRKIA
FT                   ADKRGRVGRKKKTPLRNPEIPPLRDSEIRRAS"
     atggcggaat tcaaccctcg cgacaaaagc cgaaccagtc aaggaaagac gcgggcgatg        60
     gtgcgcaggc ataccgctcc gccgagcggc atggatgacg gcagtcttcg ctggcaatgg       120
     ttcaccattc agttgctgga atctgcggcc ttcacgacat tgagtgcgaa tgcctgccgc       180
     gccttcttcc gcatcgtcat cgagcacacg tcgcacgccg ccttggaaaa cggcaagctt       240
     gtcgtgaccc atcctcagtt cgtgtcttac ggcgtgaccg gcgaatatgt ggccgatgcg       300
     atcgatgagc tcgaatataa ggggctgata aaagttcgcc gcggccgggc gggcagcggt       360
     gtcgcgcatc ccaaccggtt cacgctgact tttgtcggtg accatgaagg tgcgccgccc       420
     accgacgagt ggaagcgatg cacggcggaa aggtgccgga aatggtccga gaccgaccgc       480
     aagattgccg ccgacaaacg cggacgcgtc ggcaggaaga aaaaaacccc acttcggaat       540
     cccgaaatcc ccccgcttcg ggattccgaa attcgccgcg cttcgtga                    588
//

If you have problems or comments...

PBIL Back to PBIL home page