(data stored in ACNUC7421 zone)

EMBL: CP001622.PE107

CP001622.PE107       Location/Qualifiers
FT   CDS_pept        complement(101656..102354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0108"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: bja:blr7575 O-methyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54419"
FT                   /db_xref="GOA:C6AZ93"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ93"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACS54419.1"
FT                   /translation="MASPWVNDALSHAQSAFSGNSNTDILEVGGGSRTHIPLKGARYTV
FT                   VDISKEQLEKNRDAAERILGDAQTIDYGDRHFDACVFWDVLEHLESPRSALLRAHDTLS
FT                   PGGLVFVKGPILNSAKGIFTDLTPWWTHVLFYRYVLRQKNAGKPGYAPFRVEHAAEASH
FT                   SEIAGTLKDLGMDVVFVGEYVSTQVHALKDRIPPLYWLYEAFGLLLRTTSAGKIGGRET
FT                   EFLIVAKCLR"
     atggcttcgc cgtgggtaaa cgacgcgctg tcgcacgcac aatctgcgtt ttccggcaac        60
     agcaacacag atatccttga ggttggaggc ggctcccgca cgcatatccc cttgaaaggt       120
     gcgagatata ccgtcgttga tatctccaag gagcagctgg agaagaacag ggacgcggcc       180
     gagcggatcc tcggcgatgc tcaaaccatc gactatggag atcgtcactt cgacgcctgc       240
     gtcttctggg acgttctcga gcatttggaa agcccgcgct ctgccttgtt gagagcccat       300
     gacaccctgt ctcccggtgg tctggtgttc gtcaagggtc cgatcctgaa ctcagccaag       360
     gggatcttca ccgatctgac gccctggtgg acccacgtct tgttttatcg ctacgttctc       420
     aggcagaaaa acgccggaaa gccgggctac gccccattcc gcgtcgagca cgccgcagag       480
     gcatcccatt cggagattgc cgggacattg aaggacctcg gcatggatgt cgtcttcgtc       540
     ggcgaatatg tgtcgacaca ggtgcacgcg ctcaaggacc gaattccccc actttattgg       600
     ctctatgaag ctttcggcct tctgcttcgc acgacttcgg ctgggaagat cggggggcgg       660
     gagacggagt tcctgatcgt ggcaaagtgc cttcgttag                              699
//

If you have problems or comments...

PBIL Back to PBIL home page