(data stored in ACNUC7421 zone)

EMBL: CP001622.PE108

CP001622.PE108       Location/Qualifiers
FT   CDS_pept        102554..102874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0109"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000511 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54420"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ94"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000511"
FT                   /protein_id="ACS54420.1"
FT                   /translation="MTVGIFRALAALAMMTALGGCIDHANDPVLLAVGVPVNPPVVAHG
FT                   ICMTDGNAMYDEARKQYQLRAQLTGYAGADELEAETIARAAAHRQYVACLSGQGYRTLY
FT                   AN"
     atgacggtgg gaatttttcg ggctctggct gccctggcga tgatgacggc ccttggcggc        60
     tgcatcgacc atgccaatga tcccgtactc ctggcggtcg gcgtgccggt caatccgcct       120
     gttgttgcgc acggcatttg catgaccgac ggcaacgcca tgtatgacga ggcaaggaag       180
     cagtatcagc tgcgcgccca actgaccgga tatgccgggg ccgatgagct ggaggccgaa       240
     acgatagcgc gcgccgccgc ccatcgccaa tatgtcgcct gcctctccgg ccagggctac       300
     cggacattat acgcgaattg a                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page