(data stored in ACNUC7421 zone)

EMBL: CP001622.PE109

CP001622.PE109       Location/Qualifiers
FT   CDS_pept        103066..103437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0110"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000512 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54421"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ95"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000512"
FT                   /protein_id="ACS54421.1"
FT                   /translation="MKMLRLAPSTVALSALLALTSIIPAQAAPAQAVRPPAVSGVKMVQ
FT                   YKPHPGSWHGYQGFRTERPGTRRHSDGYWYPLAAFGVEAGTTGSIVRPPVNRPAAPEMC
FT                   NPTFSGSIGPGSMPCDNGY"
     atgaaaatgc tcagacttgc cccttccacc gtcgcgctta gcgcccttct cgccctcaca        60
     tcgatcatcc ccgcgcaggc ggcgcccgcc caggcggttc ggccgcctgc tgtctcgggc       120
     gtgaaaatgg tgcaatataa accacatccc gggtcctggc atggctatca aggtttccgc       180
     accgagcgcc ccggcacccg ccgccattcc gatggctact ggtatccgct tgctgctttc       240
     ggcgtcgagg ccggcaccac aggctccatc gtccgcccgc cggtgaacag gccggcagct       300
     ccggaaatgt gcaaccctac gttttctgga tcgatcggtc ccggtagcat gccttgcgat       360
     aacggctatt ga                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page