(data stored in ACNUC7421 zone)

EMBL: CP001622.PE11

CP001622.PE11        Location/Qualifiers
FT   CDS_pept        9612..9869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0011"
FT                   /product="protein of unknown function DUF1150"
FT                   /note="PFAM: protein of unknown function DUF1150; KEGG:
FT                   rec:RHECIAT_CH0000407 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54323"
FT                   /db_xref="InterPro:IPR009531"
FT                   /db_xref="UniProtKB/TrEMBL:C6AY99"
FT                   /inference="protein motif:PFAM:PF06620"
FT                   /protein_id="ACS54323.1"
FT                   /translation="MLMKEATSHLTKSELAHIGNGEVAYIRKMRTDEVAKCFPEAPDID
FT                   PTVDLWALFGADGTPILLTDNRSSTFFKAAEDELKTVSLH"
     atgttgatga aagaagccac gtctcacttg accaaatccg agcttgccca catcggcaac        60
     ggcgaggtcg cctatatcag aaaaatgcgc accgatgagg tcgccaagtg ctttcccgag       120
     gcgccggata tcgatccgac cgtcgatctc tgggcactct tcggcgccga cggtacgccg       180
     atccttttga cggacaaccg ttcgagcacc ttcttcaagg ctgccgagga cgaattgaag       240
     acggtcagcc tgcactga                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page