(data stored in ACNUC7421 zone)

EMBL: CP001622.PE110

CP001622.PE110       Location/Qualifiers
FT   CDS_pept        103592..103894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0111"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000513 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54422"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ96"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000513"
FT                   /protein_id="ACS54422.1"
FT                   /translation="MTTTFKNGLMAAAFGTILGLSAFSATAAPLQSSATEQGATTRPVA
FT                   QQETKVEHDRRTTGSIGERASETTGSTHYMMNPKKPLNQDCKLGFNPTSSSSCNY"
     atgaccacga ctttcaagaa cggcctgatg gccgctgcct tcggcacaat tctcggcctc        60
     tcggccttct cggcaacggc agctcccctt cagtcgagcg cgacggagca gggtgcgacg       120
     acgcgtccgg ttgcccaaca ggaaaccaag gttgagcacg acaggcgcac caccggttcg       180
     atcggcgagc gcgcctcgga aaccacgggc tcgacacatt atatgatgaa cccgaagaag       240
     ccgctcaacc aggattgcaa gctcggcttc aacccgacga gcagctctag ctgcaactac       300
     tga                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page