(data stored in ACNUC7421 zone)

EMBL: CP001622.PE111

CP001622.PE111       Location/Qualifiers
FT   CDS_pept        104191..104862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0112"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 12; KEGG:
FT                   ret:RHE_CH00448 phospholipid N-methyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54423"
FT                   /db_xref="GOA:C6AZ97"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ97"
FT                   /inference="protein motif:PFAM:PF08242"
FT                   /protein_id="ACS54423.1"
FT                   /translation="MTAKAACSDFLHFFRSWISNPLRVAAIAPSGDSLARIMTSEIAAL
FT                   DGPIIELGPGTGVFTRALLARGVSEADLTLIEYGPEFITSLQARFPTARVLQMDAAHLA
FT                   HADIFEGEPVGAVVSGLPLLSMSPRKIASIMAGAFAYMRPGGAIYQFTYGPRCPVPRPI
FT                   LDRLGLKAVRIGGTVRNLPPASVYRISRRKPLELSRERISYRQSETEIDDVAAFSNETG
FT                   G"
     atgactgcaa aggccgcatg ctccgatttc ctgcattttt tccgctcctg gatcagcaac        60
     ccgcttcggg tcgcggccat cgcgccgtcg ggggattcgc ttgccaggat catgaccagt       120
     gaaattgccg cactcgacgg tccgatcatc gaactcggcc cgggaaccgg cgtcttcacc       180
     cgggcgctgc tggcgcgcgg cgtcagcgaa gcggatctga ccctgatcga gtacggcccg       240
     gagttcatca cctcgctgca ggcacggttc ccgacggcgc gcgtgttgca gatggatgcc       300
     gcccatctcg cccatgccga tattttcgag ggcgaaccgg tcggcgcagt cgtcagcggc       360
     ctgcctctgc tctccatgtc gccccgcaag atcgcctcga tcatggccgg cgccttcgcc       420
     tatatgcgcc cgggcggggc catttatcag tttacctatg gtccgcgctg cccggtgccg       480
     cggccgatcc tcgatcgtct cggcctgaag gcggtgcgca tcggcggcac ggtgcgcaac       540
     ctgccgccgg cctccgtcta caggatttca cgccgcaagc cgctggaact gtcgcgcgag       600
     cgcatcagct atcgccagag cgagactgaa atcgacgacg tcgccgcctt ttccaacgaa       660
     accggcggct ga                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page