(data stored in ACNUC7421 zone)

EMBL: CP001622.PE112

CP001622.PE112       Location/Qualifiers
FT   CDS_pept        104882..105517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0113"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: transcriptional
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54424"
FT                   /db_xref="GOA:C6AZ98"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR041347"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ98"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACS54424.1"
FT                   /translation="MAENKRTETTEGRRERKRRQTRERIEHAAMSLFLQRGFEGTTIED
FT                   ITEAADVSKRSFFDYFPSKEEVVFAWQDAFADRLMAAVAARPAAESSVAAVEAAITATV
FT                   IAAVDEPGLALGELIHRTPALKARDQLKYARLEQKLAEALLLRKGGDPLERPRMRVLAA
FT                   VVIGALRVGAELWQQRPPGASLEDFAREIFADLWKMLAEFGDEAKTRL"
     atggctgaga acaagcggac ggagacaacc gaaggcaggc gggaacgcaa gcggcggcag        60
     acgcgcgagc gcattgagca tgcggcgatg tccctctttc tgcagcgcgg ctttgagggc       120
     acgacgatcg aggacatcac cgaggcggcc gatgtatcca agcgcagttt cttcgattat       180
     ttcccctcca aggaagaggt ggttttcgcc tggcaggatg ccttcgccga tcgcttgatg       240
     gcggcggtcg ccgcaaggcc ggcggcagaa tcctcggtcg ccgccgtcga ggcggcgatc       300
     acggcaaccg tcatcgctgc cgtcgacgag cctggcctgg cgcttggcga actcatccat       360
     cgcacgccgg cgctgaaggc ccgcgaccag ctgaaatacg ccaggctcga acagaagctc       420
     gccgaggcgc tgctgctgcg caagggaggt gatccgcttg agcggccccg catgcgcgtc       480
     cttgcggccg tcgtcatcgg tgcgctgcgc gtcggggcgg aactctggca gcagcgcccg       540
     ccgggcgcct cgcttgagga tttcgcccgg gagatcttcg ccgacctctg gaagatgctg       600
     gcggaattcg gcgacgaggc gaagaccagg ctttga                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page