(data stored in ACNUC7421 zone)

EMBL: CP001622.PE113

CP001622.PE113       Location/Qualifiers
FT   CDS_pept        105825..106706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0114"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG:
FT                   rec:RHECIAT_CH0000515 probable oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54425"
FT                   /db_xref="GOA:C6AZ99"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ99"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ACS54425.1"
FT                   /translation="MSNYNAAKSGTFKIGGNIEINRLGFGAMRVTGKGIWGEPSDHAES
FT                   IRTLKRLPELGVNFIDTADSYGPDVSEWLIKEALHPYGGKSVIATKGGLTRHGPDIWLP
FT                   VGRPEYLIQQAHKSLRNLGVEQIDLWQLHRIDQKVPAKEQFDAIKSLLDTGLIRHAGLS
FT                   EVSVADIEAASKHFKVATVQNRYNLVDRTSEDVLDYCTKHNIGFIPWYPLAAGDLAKPG
FT                   SLLDTIAKKHNAAPSRIALAWVLKRSPVMLPIPGTSKVKHLEENVAAVDIALSDEEFSA
FT                   LDAEGSKVFKAA"
     atgtccaatt acaacgcagc aaagtcaggc accttcaaga tcggcggcaa tatcgagatc        60
     aatcgtctcg gtttcggcgc catgcgcgtc accggcaagg gcatctgggg cgagccttcc       120
     gatcatgccg aatccatccg tacgctgaag cgcctgccgg aactcggcgt gaactttatc       180
     gatacggccg attcctacgg ccccgatgtc tccgaatggc tgatcaagga agcgctgcat       240
     ccctatggcg gcaagtcggt catcgccacc aagggcggcc tgacccgcca cggacccgat       300
     atctggctgc ctgtgggacg tccggaatac ctgatccagc aggcgcataa gagcctgcgc       360
     aatctcggcg tcgagcagat cgatctctgg cagctgcaca ggatcgatca gaaggtgccg       420
     gccaaggaac agttcgatgc gatcaaatcg ctgctcgata ccggcctcat ccgccatgcg       480
     ggtctcagcg aagtgtccgt tgccgacatc gaggccgcct cgaagcactt caaggtcgcg       540
     accgtccaga accgctacaa tctcgtcgat cgcaccagcg aggacgtgct cgattattgc       600
     accaagcaca atatcggctt catcccctgg tacccgctcg ccgcgggcga tctcgccaag       660
     cccggctcgc tgctcgatac gatcgccaaa aagcacaatg ccgcacccag ccggatcgcg       720
     ctcgcctggg tgctgaagcg cagcccggtc atgctgccga tccccggcac ctccaaggtc       780
     aagcatcttg aggaaaacgt ggcggcggtt gatatcgcgc tgtcagacga ggaattctcc       840
     gccctcgacg ccgagggcag caaagtcttc aaggctgctt ga                          882
//

If you have problems or comments...

PBIL Back to PBIL home page