(data stored in ACNUC7421 zone)

EMBL: CP001622.PE114

CP001622.PE114       Location/Qualifiers
FT   CDS_pept        107377..108654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0115"
FT                   /product="protein of unknown function DUF900 hydrolase
FT                   family protein"
FT                   /note="PFAM: protein of unknown function DUF900 hydrolase
FT                   family protein; KEGG: rec:RHECIAT_CH0000517 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54426"
FT                   /db_xref="InterPro:IPR010297"
FT                   /db_xref="InterPro:IPR014586"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZA0"
FT                   /inference="protein motif:PFAM:PF05990"
FT                   /protein_id="ACS54426.1"
FT                   /translation="MIGKRGGLPAALTGLLIATMALAGCGGRPVGVMQAAGTAAPGTSK
FT                   VDLLVATTRAADDNPAVLFSGERGTGLAVNAVDVSIPPEANRKVGQVQWPSRLPADPLR
FT                   DFVTVSVDPLEGERAGETWLKSHMPKSRRVLVFVHGFNNRYEDAVYRFAQIVHDSHADV
FT                   APVVFTWPSRGSIFDYNYDKESTNYSRDALEELLTRTAANPAVSDVTIMAHSMGTWLTV
FT                   EALRQMAIRNGHVASKINNVILASPDLDVDVFGRQFASLGKERPHFTIFVSQDDRALAL
FT                   SRRISGNVDRLGQIDPSVEPYRSKLEAAGITVLDLTKLKGGDRLNHGKFAESPEVVKLI
FT                   GDRLIAGQTITDSNVGLGEAVGAVAMGAAQTAGSAVSVAVSTPIAIFDPRTRRNYDAQL
FT                   KRLGQSMNNTVGSVGDSVGAGLPASQ"
     atgatcggca aaagaggcgg cttgcccgcg gctctgacag gtcttctgat tgcaacgatg        60
     gcgctcgccg gctgcggcgg caggccggtc ggtgtcatgc aggcggccgg caccgcggcc       120
     cccggcacct ccaaggtcga cctgctcgtc gcgacgacgc gcgctgccga cgacaatccc       180
     gccgtgcttt tctccggcga acgcggcacc gggcttgccg tcaatgccgt cgacgtctcc       240
     attccgccgg aagccaatcg caaggtcggc caggtgcaat ggccaagccg cctgccggcc       300
     gatccgctgc gcgatttcgt cacagtttct gtcgatccgc tggaaggcga gcgggccggc       360
     gagacgtggc tgaagtccca tatgccgaag agccgccgcg tactggtctt cgtccacggc       420
     ttcaacaatc gttatgagga tgccgtctac cgcttcgcgc agatcgtcca cgattcgcat       480
     gccgacgttg cgcccgtcgt cttcacctgg ccttcgcgcg gcagcatctt cgattataat       540
     tacgacaagg aaagcaccaa ctattcccgc gacgcgctgg aggaattgtt gacccgcacc       600
     gccgccaatc ccgccgttag cgacgtcacc atcatggccc attcgatggg cacctggctc       660
     accgtcgaag cgctgcggca gatggcgatc cgcaacggtc atgtcgcctc gaagatcaac       720
     aatgtcatcc tcgcttcgcc ggatctcgat gtcgacgttt tcggccgcca gttcgccagc       780
     ctcggcaagg aaaggccgca cttcaccatc ttcgtctcgc aggacgatcg cgctttggcg       840
     ctgtcgcggc gcatctccgg caatgtcgac cggctcggcc agatcgatcc ttccgtcgaa       900
     ccctatcgca gcaagctcga agcggccggc atcaccgtgc tcgacctcac caagctcaag       960
     ggcggcgacc ggctgaacca cggcaaattc gccgaaagcc ccgaagtggt gaagctgatc      1020
     ggcgaccggc tgattgccgg ccagacgatc accgattcca atgtcggcct cggcgaggcc      1080
     gtcggcgccg tggcgatggg cgctgcccag accgccggaa gtgccgtcag cgtcgccgtc      1140
     agcacgccga ttgcgatctt cgatccgcgc acccggcgca actacgatgc ccagctgaaa      1200
     cgtctcggcc agtcgatgaa caataccgtc ggttcggtcg gcgacagcgt cggcgccggc      1260
     ctgccggcaa gccagtaa                                                    1278
//

If you have problems or comments...

PBIL Back to PBIL home page