(data stored in ACNUC7421 zone)

EMBL: CP001622.PE115

CP001622.PE115       Location/Qualifiers
FT   CDS_pept        108839..110089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0116"
FT                   /product="D-amino-acid dehydrogenase"
FT                   /EC_number="1.4.99.6"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   ret:RHE_CH00451 D-amino acid dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54427"
FT                   /db_xref="GOA:C6AZA1"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZA1"
FT                   /inference="protein motif:PRIAM:1.4.99.1"
FT                   /protein_id="ACS54427.1"
FT                   /translation="MADETKKTVAVVGAGVIGASIAFELQRRGFDVTLIDKGEPGRGTS
FT                   FGNMASIALDFAAGSGPSTWKKIPGWLLDPEGPVWLRPSYAARMLPWFLRFLAAGRPSR
FT                   LREIEDAGMRLSNRALGDFRQMLQAIGAPELMTEEGCLAIYETEAEFAADRGHLAMMQR
FT                   YGLEFEVLSNGAIQHYEPTLSPAIAKAVLLPDNKSIRDPYKLVVKLADAAKAAGTTFVS
FT                   GTVRNIERRGDGTAVVLLEDGRRIEAGSVVLAAGVHTRFLAEKLGEPIPLETERGYHTQ
FT                   IMKPGIAMRYSVIWPHRAFMVTPTAGGIRVGGNVELAGLDAAPDFRRPRVLVRHAQRAL
FT                   PGLKVEETTEWMGHRPALPDTIPIISPSSKLPGVFYATGHGHLGLTFSATTALVIADMV
FT                   TGLKPSLDMTPFRIDRY"
     atggcggatg agacgaagaa gacggtagcg gtcgtcggcg caggcgtgat cggcgcttcg        60
     atcgctttcg agctgcagcg gcgcgggttt gatgtgacgc tgatcgacaa gggcgagccg       120
     ggtcgcggca cctctttcgg caatatggca agcatcgcgc tcgattttgc cgccggttcc       180
     ggcccttcga cctggaagaa gatccccggc tggctgctcg atccggaagg tcccgtctgg       240
     ctgcggccct cctatgccgc caggatgctg ccctggttcc tgcgcttcct cgctgccggc       300
     cggccctcgc gcctccgaga gatcgaggat gccggcatgc gcctgtcgaa ccgggcgctc       360
     ggcgatttca ggcagatgct ccaggcgatt ggcgcacccg agttgatgac cgaggagggt       420
     tgtctcgcga tctacgagac cgaggcggaa tttgccgccg accgtggcca tctcgccatg       480
     atgcagcgct acggcctcga attcgaggtt ttgagcaacg gcgccatcca acattacgaa       540
     cccactttgt caccggcgat cgccaaagcc gtactgctcc ccgacaacaa gtcgatccgc       600
     gacccctaca agctggtggt caaactcgcc gatgccgcaa aggctgcggg cacgaccttc       660
     gtctccggca ctgtcaggaa tatcgagcgc aggggcgatg gcacggccgt cgttctcctc       720
     gaggatggca ggcggatcga ggccggttcg gtcgtgcttg ccgccggcgt ccacacccgt       780
     ttcctcgccg aaaagctcgg cgagccgatc ccgctcgaaa ctgagcgcgg ctatcacacg       840
     cagatcatga agcccggcat cgcgatgcgt tattcggtga tctggccgca tcgcgccttc       900
     atggtgacgc cgacggcggg cggcatccgg gttggcggca atgtcgagct cgccggcctc       960
     gatgccgcgc ccgatttccg ccgtccgcgg gtgctggtgc gccatgccca gcgcgcgctg      1020
     cccggcctga aggtcgagga gacgacggaa tggatggggc accgtccggc gctgcccgat      1080
     acgatcccga tcatttcgcc gtcgtcgaaa ctgcccggcg ttttttatgc gaccggccac      1140
     ggccatctcg gcctgacctt ttcggcaacg acagcgctgg tgatcgccga tatggtgacc      1200
     gggctcaaac catccctcga tatgaccccg ttccgcatag accgttatta g               1251
//

If you have problems or comments...

PBIL Back to PBIL home page