(data stored in ACNUC7421 zone)

EMBL: CP001622.PE116

CP001622.PE116       Location/Qualifiers
FT   CDS_pept        110099..110809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0117"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54428"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZA2"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACS54428.1"
FT                   /translation="MSDTAKPVALITGGGRGMGEAIARELSAQGYRLALMSPSESCEKL
FT                   AAELGGVASRGVAEKAEDLKAIFDLTMKTYGRIDAVVNLSGHPPKGDLLDISDENWTLG
FT                   SDMMILSLVRMARLVTPVMLKQGKGAFVNITTFAAYEPTLVFPVSCTYRAAAGAFTKLY
FT                   SDRYAADNIRMNCILPGYIDSLNHKPETAEKVPMKRIGHVEEIAKTAAFLLSDGAGYIT
FT                   GQNIRVDGGVTRHV"
     atgtccgata ccgccaaacc cgtagcgctg atcaccggcg gcggccgcgg catgggcgag        60
     gcgatcgccc gcgagctctc ggcccagggc tatcggctgg cgctgatgtc gccttcggaa       120
     agctgcgaga agctggcggc tgaacttggc ggcgtcgctt cgcgcggcgt ggccgaaaag       180
     gccgaggatc tcaaggcgat cttcgacctg acgatgaaga cctatggccg catcgatgcc       240
     gtcgtcaacc tgagcggcca tccgccgaag ggcgacctgc tcgatatttc agacgagaac       300
     tggacgctcg gttccgacat gatgatcctg tcgctggtgc gcatggcccg cctggtcaca       360
     ccggttatgc tgaaacaggg caagggcgcc ttcgtcaaca tcaccacctt cgccgcctac       420
     gagccgacgc tggtcttccc ggtttcctgc acctaccgcg ccgctgccgg cgccttcacc       480
     aagctctatt ccgatcgtta tgcggccgat aatatccgca tgaactgcat cctgccgggt       540
     tatatcgata gtctcaacca caagcccgag accgccgaga aggtgccgat gaagcgcatc       600
     ggccatgtgg aggagatcgc caagaccgcg gccttcctgc tctccgacgg cgcgggttat       660
     atcaccggcc agaatatccg cgtcgatggc ggcgtcaccc gtcacgtctg a                711
//

If you have problems or comments...

PBIL Back to PBIL home page