(data stored in ACNUC7421 zone)

EMBL: CP001622.PE117

CP001622.PE117       Location/Qualifiers
FT   CDS_pept        110825..111862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0118"
FT                   /product="Proline racemase"
FT                   /EC_number="5.1.1.4"
FT                   /note="PFAM: proline racemase; KEGG: ret:RHE_CH00452
FT                   proline racemase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54429"
FT                   /db_xref="GOA:C6AZA3"
FT                   /db_xref="InterPro:IPR008794"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZA3"
FT                   /inference="protein motif:PRIAM:5.1.1.4"
FT                   /protein_id="ACS54429.1"
FT                   /translation="MRWKRTIQLLDVHAEGEIGRVAIGGVPKIPGETIAAQLHWLNTDP
FT                   KGDELRRFLCLEPRGAPIGSVNLLLPARHPEADAAFIILQPDQAHASSGSNSICVTTAL
FT                   LESGIVEMKEPETIVTLETAAGLVKATATCRDGRCEKVKLTMVPSFVHELDVAIDTPHW
FT                   GRIKADISYGGIFYALVDVGQIGLTIEKANAAGLVQAGMILKELINRDIKVVHPEIPAI
FT                   SGVAYVMFRDTEADGTVRTCTTMWPGRADRSPCGTGNSANLATLYARGKAKVGDTFTSK
FT                   SIIGSEFEVGLQAVTEVAGRPAVIPTITGRGFTFGLTQVALDPFDPHPNGFALTDVWGP
FT                   SAGEI"
     atgagatgga agcgcacgat ccagctgctg gatgtccacg ccgaaggtga gatcggccgc        60
     gtcgcgatcg gcggcgtgcc gaagatcccc ggcgagacca tcgccgccca gctgcattgg       120
     ctgaacaccg atccgaaggg cgacgaactg cgccgcttcc tttgcctgga gccgcgcggc       180
     gcgccgatcg gctcggtcaa cctgctgctg ccggcacggc acccggaggc cgacgccgcc       240
     ttcatcatcc tgcagcccga tcaggcgcat gcgagctccg gctcgaactc gatctgcgtc       300
     accacggcac tgctcgaatc cggcatcgtc gagatgaagg agccggagac gatcgtgacg       360
     ctcgaaaccg ccgccggcct cgtcaaggcg acggcaacct gccgagacgg gcgctgcgag       420
     aaggtcaagc tcaccatggt gccctccttc gtgcatgagc tcgatgtcgc gatcgacacg       480
     ccgcattggg gaaggatcaa ggccgatatc agctatggcg gcatctttta tgcgctcgtc       540
     gatgtcggcc agatcggtct gacgatcgag aaggccaatg ccgccggcct cgtccaggcc       600
     ggcatgatcc tcaaggagct gatcaaccgc gacatcaagg tcgtccatcc cgagatcccg       660
     gcgatctcgg gcgtcgccta tgtgatgttc cgcgacacgg aagccgatgg cacggtgcgc       720
     acctgcacca ccatgtggcc gggccgggcc gaccgctcgc cctgcggcac cggcaattcc       780
     gccaatctcg ccacccttta tgcccgcggc aaggccaagg tcggcgacac cttcacctcg       840
     aagtcgatca tcggctccga attcgaagtc ggcctccagg cggtgaccga ggtggccggc       900
     cgccccgccg tcatccccac catcaccggc cgcggcttca ccttcggcct gacccaggta       960
     gcactcgacc cctttgaccc gcatccgaac ggttttgcgc tgacggatgt gtgggggcca      1020
     tcggctgggg agatttga                                                    1038
//

If you have problems or comments...

PBIL Back to PBIL home page