(data stored in ACNUC7421 zone)

EMBL: CP001622.PE119

CP001622.PE119       Location/Qualifiers
FT   CDS_pept        complement(113470..114153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0120"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: rpt:Rpal_2059
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54431"
FT                   /db_xref="GOA:C6AZA5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZA5"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACS54431.1"
FT                   /translation="MQKSDETSNVDETPTRGRGRPRAFDREAALAQATRLFWIKGFEAT
FT                   SIADLTEAMGIGSPSLYAAFGSKEALYAEALRHYRDNNEALVWGGFFSAGTAREAVRSF
FT                   LMDSAAALTGCVVDIPRGCMVALSSVGSEGHVELGELVRAARAVTLDRLKLRLNQAISE
FT                   GEIPVSTDVHALARFVQTVQNGMSILARDGATRGELEAVAELAMLGWDTRTGDSERRQT
FT                   YADHA"
     atgcaaaaat cggatgagac ctcgaacgtc gatgaaaccc cgacccgcgg gcgcggacgg        60
     ccgcgggcgt tcgatcggga agcagccttg gcgcaggcga cccgcctgtt ctggatcaag       120
     ggcttcgagg cgacctcgat cgccgacctc accgaggcga tggggatcgg atcgccgagc       180
     ctttacgcgg cattcggctc gaaagaggcg ctctatgccg aggcgctgcg ccactatcgc       240
     gacaacaacg aggcgctcgt ctggggaggc ttcttttccg cgggcacggc ccgtgaggcg       300
     gtgaggtcgt ttctgatgga ttcggccgct gccctgaccg gctgtgtcgt ggatattccc       360
     cgcggctgca tggtggcgct ctcttcggtc ggcagcgagg gccatgtgga actcggcgaa       420
     ctcgtgcgag ccgcccgcgc cgtcacgctc gaccgcctga agctgcgcct gaaccaggcg       480
     atatcagagg gcgaaattcc cgtctcgacc gacgtccatg cactcgcccg tttcgtccag       540
     accgttcaga acggcatgtc gatcctggcc cgcgacggcg cgacccgcgg cgaactggag       600
     gcagtcgccg agttggccat gctgggttgg gacactcgaa ccggggattc tgagcgcagg       660
     cagacttacg ccgatcatgc gtaa                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page