(data stored in ACNUC7421 zone)

EMBL: CP001622.PE12

CP001622.PE12        Location/Qualifiers
FT   CDS_pept        complement(10030..10296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0012"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH02662 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54324"
FT                   /db_xref="InterPro:IPR018735"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYA0"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH02662"
FT                   /protein_id="ACS54324.1"
FT                   /translation="MCRNIKPLFNFDPPATDEEIHDAALQFVRKVSGATKPSKRDELAF
FT                   EHAVSSIAACARELLDSLETSQPPRDREEVAAKARARTAVRFA"
     atgtgccgaa atataaaacc cctgttcaat ttcgatccgc ccgcgacgga tgaggagatc        60
     cacgatgccg cgctgcagtt cgtgcgcaaa gtgagcggag cgaccaaacc gtcgaagcgc       120
     gatgagctcg cattcgagca cgcggtcagt tcgatcgcag catgcgcccg cgagctgctc       180
     gattcgctgg aaacgtctca acctcctcgt gatcgtgagg aggtagcggc aaaggcgcgc       240
     gcgagaacgg cggtccgctt cgcgtaa                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page