(data stored in ACNUC7421 zone)

EMBL: CP001622.PE120

CP001622.PE120       Location/Qualifiers
FT   CDS_pept        114235..114975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0121"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: atc:AGR_pAT_252 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54432"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZA6"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACS54432.1"
FT                   /translation="MTELAGKRALVTGGSRGIGAAIALALADKGADVAITYERSADRAA
FT                   EVVRAIEGKGRKALAIQADSADPAAVKRSVDEAAQALGGLDILVNNAAIALYGAIADVS
FT                   VEQIDALLDVNVRSPLLASQAAIPYLQAGGRVITIGSVGAERIVGDTGTVYYMTKSALH
FT                   SFTRGLARELGSRDITVNLVQPGSTDTDMNPADGDFADFQRALIPLGRYGEPEDVAAAV
FT                   AFLASPAARHITGTILTVDGGLNT"
     atgacagaac tggctggaaa gcgtgccctg gtcacaggtg gctcgcgtgg catcggtgcc        60
     gccatcgcat tggcgcttgc cgacaaaggc gcggatgtcg ccataaccta tgagcgttcg       120
     gccgatcgcg ccgccgaagt cgtccgagcg atcgagggca agggccgcaa agcgcttgcc       180
     atccaggccg acagcgccga tccggcggcc gtgaagcgct cggtcgacga ggccgcccag       240
     gcacttggcg gtctcgacat tctcgtcaac aatgccgcaa tcgcgcttta cggtgcgatc       300
     gccgacgtca gcgtcgagca gatcgatgcg ctgctggatg tcaatgtgcg gtcgcctctg       360
     ctcgcttcgc aggccgccat tccctatctg caggcgggag gccgcgtcat caccatcggc       420
     tcggtcggcg ccgaacgcat cgtcggcgac accggcacgg tctattacat gacaaaatcc       480
     gcgctccact cgtttacccg cggcctcgcg cgggaactcg gatctcgcga tatcaccgta       540
     aacctcgttc agccgggttc gaccgacacc gatatgaatc ccgccgatgg cgacttcgcc       600
     gatttccagc gtgccctgat cccacttggc cgttatggcg agccggaaga tgtggcggct       660
     gctgtggctt tcctcgcaag ccctgctgca aggcacatca ccggcaccat cctcacagtg       720
     gatggcggct tgaacacctg a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page