(data stored in ACNUC7421 zone)

EMBL: CP001622.PE121

CP001622.PE121       Location/Qualifiers
FT   CDS_pept        complement(115478..117025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0122"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="KEGG: rec:RHECIAT_CH0000527 putative sensory
FT                   box/GGDEF family protein; TIGRFAM: diguanylate cyclase;
FT                   PFAM: EAL domain protein; GGDEF domain containing protein;
FT                   SMART: EAL domain protein; GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54433"
FT                   /db_xref="GOA:C6AZA7"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZA7"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACS54433.1"
FT                   /translation="MPRSQPTRPQIEIVAWLAIFLLLFCLSWLFQWHEGLDEFIEKHHD
FT                   YPLDHALLALNISGFLGLIYSALRIRDLSREVHRRLQAEKNVDWIACHDTLTELPNRRF
FT                   LDSICAQAMSDQRAQETYAVFSIDLDGFKKVNDLLGHDHGDAVLKTVAQRLSSLFPRER
FT                   VFRLGGDEFVVLARRTGNPDLVALGNRIVTVIGKPFTFNGVAVDLGASVGFALFPENGD
FT                   DLGQVIRHSDCAMYVAKKQGRNLVKPFVPSMQDELAKRVRLEADLRAAIKKAEIVPYYQ
FT                   PLVDLKTNRIIGFEALARWKTASGEFIPPNEFIPVAEEAGLIVELTDQLLRHACADALS
FT                   WPNELVLSFNLSPIQLSDRLLGLRILKILGDVGLPAHRVELEVTESAIIQDAVTARIVL
FT                   DDLVNAGVRIALDDFGTGYSSLSQLSNYRFDKIKIDRSFVSSFETNDKQDKVIKAIIAL
FT                   GAGLGVTITAEGIEEESQLQRLQDLGCDIGQGYLLGRPAPAAELATDHVSTRILQRG"
     atgcctcgca gccaaccaac cagaccgcag atcgagatcg ttgcctggct cgcgatcttc        60
     ctgcttctct tctgcctatc ttggctcttc caatggcatg aagggctgga tgagtttatc       120
     gagaagcatc atgactatcc gctggaccac gcgctcctcg ccctgaatat ctccgggttt       180
     ctcgggctca tctattccgc gctgaggatc cgggatcttt cgagggaggt tcatcgcagg       240
     ctgcaggccg aaaagaacgt agactggatt gcctgtcacg acacgctgac cgaactgcct       300
     aaccgcagat ttctggattc tatatgcgcg caggcgatga gcgatcagag ggcacaagag       360
     acctatgccg tgttcagcat cgatctcgac ggcttcaaga aggtcaatga tctcctgggg       420
     catgatcacg gtgatgcggt gctgaagact gttgctcagc ggctctcttc cctctttccc       480
     cgtgagcgcg ttttccgcct tgggggagac gagttcgttg ttctggcgcg gcgcactgga       540
     aatcccgatc ttgttgcgtt ggggaaccgc atcgtgaccg tgatcggcaa gccgttcaca       600
     ttcaatggtg tcgccgtcga cctcggcgcc agtgtcggct tcgcgctttt tccggagaac       660
     ggcgatgacc tcggtcaggt cattcgacat tccgactgtg cgatgtatgt cgccaaaaag       720
     caggggcgca atctggtgaa gcccttcgtg ccttcgatgc aggacgagtt ggcgaagcgg       780
     gtccggctgg aagctgatct gagagcagcc atcaagaagg cagagatcgt tccctactat       840
     cagccgctcg tggacctgaa aacgaatagg attatcggct tcgaggcctt ggcacgctgg       900
     aagacggcct ccggcgaatt catcccaccg aacgaattca ttccggtggc agaggaagcc       960
     ggtctgatcg tcgaattgac agaccagctg cttcgccacg cctgcgccga tgcgctttcc      1020
     tggccaaatg agctcgtcct gtcattcaac ctttctccga tccaactaag cgaccgactg      1080
     ctggggctta gaattctcaa gatattgggc gatgtcggtc tgccggcgca cagggtcgag      1140
     cttgaggtga cggagagcgc catcatccaa gacgccgtca ctgcgcgaat cgtcctcgac      1200
     gatctggtga acgccggcgt caggattgct ctcgacgact ttggaacagg ttattccagc      1260
     ctctcacaac tatccaacta ccggttcgat aagatcaaga tcgacaggag tttcgtctct      1320
     tcattcgaaa ccaatgataa gcaggacaag gtgatcaagg ccatcatcgc tctcggtgcg      1380
     ggacttggcg tgacgataac cgccgagggt atcgaagaag agagccagct tcagcggctt      1440
     caggatctgg gttgcgacat cggccaagga tatctgcttg gtaggccagc cccggccgcg      1500
     gagcttgcca cagatcacgt cagcactaga attttgcaac gcggttga                   1548
//

If you have problems or comments...

PBIL Back to PBIL home page