(data stored in ACNUC7421 zone)

EMBL: CP001622.PE122

CP001622.PE122       Location/Qualifiers
FT   CDS_pept        complement(117457..118131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0123"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: smd:Smed_4441 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54434"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZA8"
FT                   /inference="similar to AA sequence:KEGG:Smed_4441"
FT                   /protein_id="ACS54434.1"
FT                   /translation="MAPDMSTVPRRSTTGLRKFLDPEQQRDWVEGEADLIDAEERSESL
FT                   EQRFKYVARYEKLLRRPQAQDVLEILRVYGQTCIPIPRKTERHYWSVSCLPSTSDKPLI
FT                   RVNASWMELFTLYADGEGLRARFLVHLSHFTTDHSPAQGDVDEPFLEDCVTTPEDVGYF
FT                   FPRGEDIFGITVRGSASIRKFLAERRILRAIRTFNVTHMNRGRNAYQASHCYSLADTML
FT                   AD"
     atggcaccag acatgagcac ggtccctcgt cgcagcacca ctggtctgcg caagtttctg        60
     gatcctgagc agcagcgcga ttgggtagaa ggcgaggcgg atttgatcga cgccgaagag       120
     cgctcggagt ccctggaaca gcggttcaaa tacgtcgccc ggtacgagaa gctgcttcgt       180
     cgcccgcagg cgcaagacgt tctggaaatt ctcagggtat atgggcaaac ctgcatcccc       240
     atccctcgca agaccgagcg tcactactgg tcggtttctt gtctgccctc gacctcagac       300
     aagccgctca tccgcgtcaa tgcgagctgg atggagcttt tcacgctcta tgccgacggc       360
     gagggcctgc gtgcacgatt cctcgtgcat ctttcgcatt tcactacgga ccattcaccc       420
     gcgcagggcg atgtcgacga gccttttctc gaggactgcg tcacgacgcc cgaagacgtc       480
     ggttattttt ttccgcgcgg cgaggacatt ttcggcatca ctgtgcgggg ctcggcctcg       540
     atccgcaaat tcctcgcgga gcgccgcatc ttgcgcgcca ttcggacttt caatgtgacg       600
     cacatgaacc gaggtcggaa cgcctatcag gcgagccact gctacagcct ggcggatacc       660
     atgctggcag attga                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page