(data stored in ACNUC7421 zone)

EMBL: CP001622.PE123

CP001622.PE123       Location/Qualifiers
FT   CDS_pept        complement(118384..118860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0124"
FT                   /product="RbsD or FucU transport"
FT                   /note="PFAM: RbsD or FucU transport; KEGG: ret:RHE_CH00463
FT                   fucose dissimilation pathway protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54435"
FT                   /db_xref="GOA:C6AZA9"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZA9"
FT                   /inference="protein motif:PFAM:PF05025"
FT                   /protein_id="ACS54435.1"
FT                   /translation="MLKGLDPLLSPELLLTLRAMGHGDEIAIVDGNYPGVEHARRLIRL
FT                   DGHHLIPVLNAVLSVLPIDDFVAEAIFRSTVKAERDKLDPVHEEMIDCCARHEPHRQVV
FT                   PLIGQDFYGRVKTAHALIQTGEPRLYANIILRKGVIYPKEPGTHAAAGVDPFVY"
     atgctgaaag gacttgaccc gctgctgagc ccggagctgc ttttgacgct tcgcgccatg        60
     ggtcacggcg acgagatcgc catcgtcgac ggcaattatc cgggcgtcga acatgcccgc       120
     cggctgatcc ggctcgacgg ccaccacctc atcccggtcc tcaatgccgt gctcagcgtg       180
     ctgccgatcg acgacttcgt ggcggaagcg atcttccgct cgaccgtcaa ggccgagcgc       240
     gacaagctcg acccggtgca tgaggagatg atcgactgct gcgcccgcca cgagccgcac       300
     cggcaggtgg tgccgctgat cggccaggat ttctacggaa gggtgaagac cgcccatgcg       360
     ttgatccaga ctggcgagcc caggctctat gcgaacatca tcctgcgcaa gggcgtgatc       420
     tatccgaaag agccgggcac ccatgccgcg gccggagtcg atccgttcgt ctattag          477
//

If you have problems or comments...

PBIL Back to PBIL home page