(data stored in ACNUC7421 zone)

EMBL: CP001622.PE124

CP001622.PE124       Location/Qualifiers
FT   CDS_pept        complement(118844..120091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0125"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG:
FT                   rec:RHECIAT_CH0000535 sugar transcriptional regulator
FT                   protein, ROK family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54436"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZB0"
FT                   /inference="protein motif:PFAM:PF00480"
FT                   /protein_id="ACS54436.1"
FT                   /translation="MSTLDGPEHTPVPPPILNPAGGANQVRVRAYNERLVLSLVRLYGT
FT                   LSKADIARRSGLSAQTVSVIMRVLEKEGLLSRGEPVRGRVGQPSIPMHINPDAVYSFGL
FT                   KMGRRSADLVLMDFVGRIRMQLHRTYAYPLPDEILAFVTSGIRELEDRLDDKQRSRIAG
FT                   LGIAAPFELWNWAEEVGAPPGAMEVWRDVDLQADIAARVSHPVFMQNDATSACGAELVF
FT                   GVGPSYPDFVYFFIGSFIGGGIVLNSAIFSGRTGTAGAIGPLPVRGKNGETMQLLEIAS
FT                   IFVLENMLRERGIDPEPLWYSADGWVDFGEPMEAWIQDSAKALAQAIVAAASIVDFSAA
FT                   VIDGGFPDWVRSRVVQATIDEAAKLDLQGVVMPEIIEGAVGAQARAIGGASLPIFARYL
FT                   TDQNVLFKEVDHAERT"
     atgtcgacct tggatggacc ggaacacacg ccggtcccgc caccaattct gaatccggcc        60
     ggaggtgcga accaggtcag ggtgcgagcc tataacgaac ggctcgtgct gtcgctggtg       120
     cgtctctacg gcacgctgtc gaaggccgat atcgcgcgtc gcagcggact gtcggcgcag       180
     accgtctccg tcatcatgcg ggtgctggaa aaggaagggc tgctgtcgcg cggggaaccg       240
     gtgcgcggcc gtgtcggcca gccgtcgatc ccgatgcata tcaatcccga tgccgtctat       300
     tccttcggcc tgaagatggg ccggcgcagc gccgatctgg tgctgatgga tttcgtcggc       360
     cgcatccgca tgcagctgca ccggacctat gcctatccgc tgccggatga aatcctcgcc       420
     ttcgtcacct cgggcatccg ggagctggaa gaccggctcg acgacaagca acgtagccgc       480
     atcgccggcc tcggcatcgc cgcccctttc gagctctgga actgggccga agaggtgggc       540
     gccccgccgg gcgccatgga ggtctggcgc gacgtcgacc tgcaggccga catcgccgcc       600
     cgcgtctccc atccggtctt catgcagaac gatgcgacca gcgcctgcgg cgccgaactg       660
     gtcttcggcg tcggaccgtc ctacccagat ttcgtctatt tcttcatcgg ctccttcatc       720
     ggcggcggca tcgtgctcaa ttcggcgatc ttttccggcc gcaccggcac ggcgggcgcg       780
     atcgggccgc tgccggtgcg cggcaagaac ggcgagacga tgcagctgct cgaaatcgcc       840
     tcgatcttcg tgctcgaaaa catgctgcgc gagcgcggca tcgatcccga gccgctctgg       900
     tattcggccg acggctgggt ggatttcggc gagccgatgg aagcctggat ccaggacagc       960
     gccaaggcgc tggcgcaggc gatcgttgcc gccgcctcga tcgtcgattt cagcgcggct      1020
     gtgatcgacg gcggctttcc cgattgggtg cgcagccggg tggtgcaggc cacgatcgac      1080
     gaagccgcca agctcgacct gcagggcgtc gtcatgcccg aaatcatcga gggcgcggtc      1140
     ggcgcgcagg cgcgcgccat cggcggcgcc agcctgccga tctttgcgcg ttacctcacc      1200
     gaccagaacg tactcttcaa ggaggtagac catgctgaaa ggacttga                   1248
//

If you have problems or comments...

PBIL Back to PBIL home page