(data stored in ACNUC7421 zone)

EMBL: CP001622.PE125

CP001622.PE125       Location/Qualifiers
FT   CDS_pept        120320..121339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0126"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: ret:RHE_CH00465 fructose
FT                   ABC transporter, substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54437"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZB1"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ACS54437.1"
FT                   /translation="MKKSVLAFGALALGVTFSAPVMAADVAACLITKTDTNPFFVKMKE
FT                   GATAKAKELGVSLKSYAGKVDGDSESQVAAIESCIADGAKGILIAASDTKGIVSSVKKA
FT                   RDAGLLVIALDTPLEPADAADATFATDNLLAGKLIGQWAKETMGDKAKDAKVGFLDLTP
FT                   SQPTVDVLRDQGFMMGFGIDPKDPNKIGDEDDARIVGHDVTNGNEEGGRKAMENLLQKD
FT                   PSINVIHTINEPAAVGAYQALKAVGMEKNVLIVSVDGGCPGVKSVKEGVIGATSQQYPL
FT                   MMAALGVEAIKKFADSGEKPKPTEGKSFYDTGVSLVTDKPVSGVKSIDTKEGTDKCWG"
     atgaagaaat ctgttctcgc tttcggcgcg ctcgcgcttg gtgtcacctt ttccgctcct        60
     gttatggcgg ctgacgttgc tgcctgcctc atcaccaaga ccgacaccaa ccccttcttc       120
     gtcaagatga aggaaggtgc gacggccaag gccaaggaac tcggcgtctc gctgaagtcc       180
     tatgccggca aggtcgacgg tgacagcgaa agccaggtgg ccgcgatcga aagctgcatt       240
     gccgacggcg caaagggcat cctgattgct gcttccgaca ccaagggcat cgtgtcttcg       300
     gtcaagaagg cccgtgatgc cggcctgctg gtcatcgcgc tcgacacgcc gctcgagccg       360
     gccgatgccg ccgacgccac cttcgccacc gacaacctgc tcgccggcaa gctgatcggc       420
     cagtgggcca aagaaacgat gggcgacaag gccaaggatg ccaaggtcgg cttcctcgac       480
     ctgacgccgt cacagccgac ggtcgacgtt ctgcgcgacc agggcttcat gatgggcttc       540
     ggcatcgatc cgaaggaccc gaacaagatc ggcgacgagg acgatgctcg tatcgtcggt       600
     catgacgtga ccaacggcaa tgaagaaggc ggccgcaagg ccatggaaaa ccttctgcag       660
     aaggatccga gcatcaacgt catccacacg attaacgagc cggccgctgt cggcgcctat       720
     caggcgctga aggccgtcgg catggaaaag aacgtgctga tcgtctcggt cgacggcggt       780
     tgcccgggcg tgaagtcggt caaggaaggc gtcatcggcg ctacctcgca gcaatatccg       840
     ctgatgatgg cagcccttgg cgtcgaagcg atcaagaagt tcgccgacag cggtgaaaag       900
     ccgaagccga ccgaaggcaa gtccttctac gacaccggcg tctcgctcgt caccgacaag       960
     ccggtttccg gcgtcaagtc gatcgacacc aaggaaggca cggacaagtg ctggggctga      1020
//

If you have problems or comments...

PBIL Back to PBIL home page