(data stored in ACNUC7421 zone)

EMBL: CP001622.PE126

CP001622.PE126       Location/Qualifiers
FT   CDS_pept        121495..122559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0127"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   rec:RHECIAT_CH0000537 fructose ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54438"
FT                   /db_xref="GOA:C6AZB2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZB2"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACS54438.1"
FT                   /translation="MTGTQEFERVLDGSDKSVASFEHEKVSLIKRAQHFLHSTPAAVPL
FT                   IVLVLAIVIFGITIGGRFFSSYTLTLILQQIAIVGILGAAQTLVILTAGIDLSIGVIMV
FT                   ISAVIMGNVAITYGIPTPIAVAAGMLVGGLCGLLNGFLVAYMKLPPFIVTLGTWNIVMA
FT                   TNFIYSANETIRDTDVDEKAPLLHLFAVSFKLGSAVLTLGVIAMVLLVLVLWYVLNHTA
FT                   WGRHVYAVGDDPEAAKLSGIQTKKVLLTVYAISGVIAGLAAWVSIGRNGSISPSSAVTD
FT                   FNLQAITATVIGGISLFGGRGSILGTLFGAMIVGVVSMGLNMLGADPQWKVLLTGVLII
FT                   AAVAIDQWIRKVSV"
     atgaccggaa cacaggaatt cgaacgtgtc ctcgacggca gcgacaagag cgttgcctcc        60
     ttcgagcacg agaaagtctc gctgatcaag cgcgcgcagc attttctgca ctcgacgccg       120
     gccgccgtgc cgctgatcgt gctggtgctg gcgatcgtca tcttcgggat caccatcggc       180
     ggacggttct tctcgtccta tacgctgacg ctcatcctgc agcagatcgc catcgtcggt       240
     attctcggcg ccgcccagac gctggtcatc ctgaccgccg gcatcgatct ttcgatcggc       300
     gtcatcatgg tgatctcggc ggtcatcatg ggcaatgtcg ccatcaccta cggcataccg       360
     acgccgatcg cggtcgcagc cggcatgctt gtcggcggcc tttgcggatt gctgaacggc       420
     ttcctcgtcg cctacatgaa gctgccgccc ttcatcgtca cgctcggcac ctggaacatc       480
     gtcatggcga cgaatttcat ctattccgcc aatgagacga tccgcgatac cgacgtcgac       540
     gaaaaggcgc cgctgctgca tcttttcgcc gtgagcttca agctcggcag cgccgtgctg       600
     accctcggcg tcatcgccat ggtgctgctc gtcctggtgc tctggtatgt cctcaatcac       660
     accgcctggg gccggcatgt ctatgccgtc ggcgacgatc cggaggcagc caagctctcg       720
     ggcattcaga ccaagaaggt gctgctgacc gtttacgcca tctcgggtgt cattgccggc       780
     ttggccgcct gggtctcgat cggccgcaac ggctcgatct cgccgtcgtc ggccgtcacc       840
     gattttaacc tccaggcgat caccgcgacg gtgatcggcg gcatctcgct gttcggcggc       900
     cgcggctcca ttctcggcac gctcttcggt gcgatgatcg tcggcgtcgt gtcgatgggc       960
     ctcaacatgc tcggcgccga cccgcaatgg aaagtccttt tgacaggcgt gctgatcatc      1020
     gccgccgtcg ccatcgatca gtggatcaga aaggtttcgg tgtaa                      1065
//

If you have problems or comments...

PBIL Back to PBIL home page