(data stored in ACNUC7421 zone)

EMBL: CP001622.PE127

CP001622.PE127       Location/Qualifiers
FT   CDS_pept        122562..123344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0128"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rec:RHECIAT_CH0000538 fructose ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54439"
FT                   /db_xref="GOA:C6AZB3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZB3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS54439.1"
FT                   /translation="MAREPLLTARGLVKRYGRVTALDNADFDLYPGEILAVIGDNGAGK
FT                   SSLIKAISGAVTPDEGVITLEGRQVQFRSPMEARDAGIETVYQNLALSPALSIADNMFL
FT                   GREIRKPGVLGSMFRMLDRPAMEKLARNKLSELGLMTIQNINQAVETLSGGQRQGVAVA
FT                   RAAAFGSKVIIMDEPTAALGVKESRRVLELILDVRARGLPIVLISHNMPHVFEVADRIH
FT                   IHRLGRRLTVIDPKEYTMSDAVAFMTGAKAVPTEPVAA"
     atggctcgcg aaccccttct caccgcccgc ggtctcgtca agcgttatgg acgcgtgacc        60
     gcgctcgaca atgccgattt cgacctctat ccgggtgaaa tcctcgccgt catcggcgat       120
     aacggcgccg gcaaatcctc gctcatcaag gcaatatcgg gcgcggttac cccggacgag       180
     ggggtgatta ccctcgaagg ccggcaggtg cagttccgct cgccgatgga ggcgcgcgac       240
     gccggcatcg agaccgtcta tcagaatctt gctttgtcgc cggcgctgtc gatcgccgac       300
     aacatgttcc tcggccgcga gatccgcaaa ccgggcgtgc tcggctcgat gttccgcatg       360
     ctcgaccggc cggccatgga aaagctggcg cgcaacaagc tgtccgaact cggcctgatg       420
     accatccaga acatcaacca ggcagtggaa acgctctccg gcggtcagcg ccagggtgtt       480
     gcggtcgccc gtgccgccgc cttcggctcg aaggtcatca tcatggatga accgacggcc       540
     gcgcttggcg tcaaggaaag ccgccgcgtg ctggagctga tcctcgacgt gcgcgcccgc       600
     ggcctgccga tcgtgctgat ctcccacaac atgccgcatg tcttcgaggt ggccgaccgg       660
     atccatatcc accgtctcgg ccggcggctg acggtgatcg atccgaagga atacaccatg       720
     tccgacgccg tcgccttcat gaccggcgcc aaggcggtgc cgacggagcc cgtcgccgca       780
     tga                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page