(data stored in ACNUC7421 zone)

EMBL: CP001622.PE128

CP001622.PE128       Location/Qualifiers
FT   CDS_pept        123341..123973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0129"
FT                   /product="putative fructose transport system kinase"
FT                   /note="KEGG: ret:RHE_CH00468 putative fructose transport
FT                   system kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54440"
FT                   /db_xref="GOA:C6AZB4"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZB4"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00468"
FT                   /protein_id="ACS54440.1"
FT                   /translation="MNARIDEIAGEVLDRAGHSKRFLVAIAGPPGAGKSTMADNLAEAL
FT                   KAKGESAEVLPMDGFHMDNAILIERGLLARKGIPETFDVRGFLDIIRAVRLADQEVLVP
FT                   VFDRSRELAIASARPVSPDHRFIIVEGNYLLFSLGKWAELEGVFDFSIMLAPPIEVLEE
FT                   RLWARWRGYNLTEEAANAKVYGNDLPNGRLILENRRPADVTLEIALA"
     atgaatgcac gcatcgatga aatcgccggc gaggtgcttg accgcgccgg ccattccaag        60
     cgtttcctgg tcgccatcgc cggaccgccg ggtgccggca aatcgaccat ggccgacaat       120
     ctggcggaag cgctgaaggc caagggcgaa agtgccgaag tcctgccgat ggatggcttc       180
     cacatggaca acgccatcct gatcgaacgc ggcctgctgg cgcgcaaggg gattcccgag       240
     accttcgatg tccgcggttt cctcgatatc atccgcgccg tcaggctggc cgatcaggag       300
     gttctggtgc cggtcttcga ccgctcgcgt gaactcgcca ttgcgtcggc tcgccccgtt       360
     tccccggatc accgcttcat catcgtcgag ggcaattatc tgctcttttc gctgggcaaa       420
     tgggccgaac tcgaaggcgt cttcgacttt tcgatcatgc tggcgccgcc gatcgaggtg       480
     ctcgaggagc ggctctgggc gcgctggcgc ggttacaacc tcaccgagga ggccgccaac       540
     gccaaggtct acggcaacga cctgccgaac ggccggctga tcctcgaaaa ccgccgcccg       600
     gccgatgtga cgctggagat cgcgctggcg taa                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page