(data stored in ACNUC7421 zone)

EMBL: CP001622.PE129

CP001622.PE129       Location/Qualifiers
FT   CDS_pept        124085..125131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0130"
FT                   /product="dihydroorotase, homodimeric type"
FT                   /EC_number="3.5.2.3"
FT                   /note="KEGG: rec:RHECIAT_CH0000540 dihydroorotase protein;
FT                   TIGRFAM: dihydroorotase, homodimeric type; PFAM:
FT                   amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54441"
FT                   /db_xref="GOA:C6AZB5"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004721"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZB5"
FT                   /inference="protein motif:TFAM:TIGR00856"
FT                   /protein_id="ACS54441.1"
FT                   /translation="MQSITIRRPDDWHLHLRDGAMLEGVIADTSRTFARAIIMPNLVPP
FT                   VVTSADAKAYRERILKALPDGHRFQPLMTLYLTEHTSPDDVEEGKNSGLITAVKLYPAG
FT                   ATTNSHGGVRDMEKAMPVLERMAKIGLPLCVHGEVTTPEVDIFDREAVFIETVLDPLRQ
FT                   RLPELKVTMEHVTTSDGVDYIKTAKGNLAGSITTHHLIINRNAILVGGIRPHYYCLPVA
FT                   KRENHRLALRAAAVSGDARFFLGTDSAPHVDPLKECACGCAGIYTSVNTMSCLAHVFEQ
FT                   EGALERLEAFVSLNGPAWYGLQPNEERITLARQADPVVFPARIETGAGPVTVFDPMFPL
FT                   HWQVVQQA"
     atgcaatcga tcaccatccg ccgtcctgat gactggcacc tgcatctgcg cgacggcgcc        60
     atgctggagg gcgtgatcgc cgatacgagc cgcaccttcg cccgcgccat catcatgccc       120
     aatctcgtgc cgccggtcgt cacgtcagct gacgccaagg cctatcgcga acgtatcctc       180
     aaggccttgc ctgatggcca tcgcttccag ccgctgatga cgctttatct gaccgaacat       240
     accagccccg atgacgtcga ggaggggaag aacagcggcc tcatcaccgc cgtcaagctt       300
     tatcccgccg gcgccacgac caattcgcat ggcggcgtcc gcgatatgga aaaggcgatg       360
     ccggtgttgg agcgcatggc aaagatcggc ctgccgctct gcgtccatgg cgaggtgacg       420
     acgccggagg tcgatatctt cgatcgcgag gccgtcttca tcgaaaccgt gctcgatccg       480
     ctgcgccagc gcctgccgga gctgaaggtg acgatggagc atgtgacgac atccgatggc       540
     gtcgattaca tcaagacggc caagggcaat ctcgccggtt cgatcaccac ccaccatctg       600
     atcatcaacc gcaacgccat cctcgtcggc ggcatccgcc cgcactatta ctgcctgccc       660
     gtcgccaagc gcgaaaacca ccggctggcc ttgcgtgcgg cggccgtcag cggtgatgcc       720
     cgcttcttcc tcggcacgga ttccgccccg catgtcgatc cgctgaagga atgcgcctgc       780
     ggctgcgccg gcatctatac ctcggtcaat acgatgagct gcctcgccca tgtcttcgag       840
     caggagggcg ctctggagcg gctcgaagcc ttcgtgtcgc tgaacgggcc ggcctggtac       900
     gggcttcagc cgaacgagga gcgcatcacc ctggcgaggc aggccgaccc ggtcgtcttt       960
     cccgcgagga ttgaaaccgg cgccggtccc gtgacggtgt tcgatccgat gtttcccctg      1020
     cattggcagg tggtacagca ggcgtaa                                          1047
//

If you have problems or comments...

PBIL Back to PBIL home page