(data stored in ACNUC7421 zone)

EMBL: CP001622.PE13

CP001622.PE13        Location/Qualifiers
FT   CDS_pept        10650..11054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54325"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYA1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS54325.1"
FT                   /translation="MNQSHRFLFHTQRPRDDGCGVLVLQMLTGMSYDEVAAMIDWGDKS
FT                   AHYTTWNDLCGVLAEIGVPIEAPIKTSRWSDIQGVAIVHVQRDHFMLYDAENGLFYDPA
FT                   EMEGPGVASDRIPTSYLTVDPSALTTAKIG"
     ttgaaccaat cgcaccgatt tctatttcat acacagcgtc cgagagacga tggatgcggg        60
     gtgttagtcc tgcagatgct caccggcatg agctatgacg aggtggcagc catgatcgat       120
     tggggcgata aatcggcgca ttatacaacc tggaacgatc tttgcggcgt gttggcggag       180
     atcggagtgc ctatcgaagc cccgatcaaa accagtcgat ggagcgatat ccagggggtc       240
     gctatcgtcc acgttcagcg ggatcacttc atgctttacg acgcggaaaa cggtctgttc       300
     tatgacccag cagagatgga aggcccaggg gtggccagcg atcgcattcc aaccagctat       360
     ctgaccgtag acccatcggc gctaaccacc gctaaaattg ggtag                       405
//

If you have problems or comments...

PBIL Back to PBIL home page