(data stored in ACNUC7421 zone)

EMBL: CP001622.PE130

CP001622.PE130       Location/Qualifiers
FT   CDS_pept        125305..126483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0131"
FT                   /product="diguanylate cyclase"
FT                   /note="KEGG: ret:RHE_CH00470 hypothetical protein; TIGRFAM:
FT                   diguanylate cyclase; PFAM: GGDEF domain containing protein;
FT                   SMART: GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54442"
FT                   /db_xref="GOA:C6AZB6"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZB6"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACS54442.1"
FT                   /translation="MMLDYNSLLLALGVSAACLAVTLMGSWLVRRSETVLLTATVGLVL
FT                   VVSGIFVYSAYVDTPETWLGVANFVLFHAGFATIWGAGKQFLTGRVSLPAIAIRALAAM
FT                   VFSVVPMLSGYDGLAFIADNLAIALLLFATARQYWLARAEAPAPLLGITVLYTLTAISF
FT                   VLCAAVLISDGKLVLGKAPSNWAEDLSLAVCIAGMTGIGALSLALHQWRLAARHRLDAI
FT                   TDPLTGLLNRRALFDQYGTRPMGTTTAVIVFDIDHFKSVNDRFGHAAGDRVLNVFSGEL
FT                   SAHCRTGDTAARLGGEEFVLVLKEIMPGRAELTAERIRRAFEAREIHIDDEVLTCTVSV
FT                   GVAPGRSKSLDFDTMLSAADKALYVAKRAGRNRVELASYLKAVPVEATRTAS"
     atgatgcttg actataactc cctcctgttg gcgctcggcg tctccgcggc ctgccttgcg        60
     gtgacgctga tgggcagctg gcttgtccgt cgctcggaaa ccgtgctgct caccgccacc       120
     gtcggccttg tcctcgtcgt cagcggcatt ttcgtctata gcgcctatgt cgatacgccg       180
     gagacatggc tcggcgtcgc caatttcgtg ctgtttcatg ccggttttgc caccatctgg       240
     ggggccggca aacaattcct caccggccgg gtgtctctcc ccgccatcgc gatccgcgcg       300
     cttgcggcga tggtcttctc cgtcgtgccg atgctgtcag gctatgacgg cctggccttc       360
     atcgccgaca atcttgccat cgcccttttg ctctttgcca ccgcccggca atactggctc       420
     gcccgtgccg aagcaccggc gccgctcctc ggcatcacgg tgctctatac gttgacggcg       480
     atctccttcg ttctctgcgc cgcggtgctg atttcagacg gcaagctggt gctcggcaaa       540
     gcccccagca actgggccga agatctgagc cttgccgtct gcatcgccgg catgaccggg       600
     atcggcgcgc tgtcgctggc gctgcatcaa tggcggctcg ctgcccgcca tcgcctcgat       660
     gcgatcaccg atccgctgac cggcctgctc aaccgccgcg ccctcttcga ccaatacggc       720
     acgcgcccga tgggaacgac gacggccgtc atcgtcttcg atatcgacca tttcaaatcc       780
     gtcaacgatc gcttcggcca tgccgccggc gaccgcgtgc tcaatgtctt ttccggcgaa       840
     ctttcggcgc attgccgcac cggcgacacc gctgcccggc tcggcggcga ggaattcgtg       900
     ctggtgctga aggagatcat gcccggccgg gcggaactga cggccgagcg catccgccgg       960
     gcgttcgagg cgcgcgagat ccatatcgac gacgaggtgc tgacatgcac ggtcagcgtc      1020
     ggcgtcgccc ccggccgttc gaagagcttg gatttcgaca ccatgctgag tgccgccgac      1080
     aaggcgctct atgtcgccaa gcgcgccggc cgcaaccggg tcgagcttgc cagctacctc      1140
     aaggcggttc ccgtcgaggc aacacgcacc gcgtcttga                             1179
//

If you have problems or comments...

PBIL Back to PBIL home page