(data stored in ACNUC7421 zone)

EMBL: CP001622.PE132

CP001622.PE132       Location/Qualifiers
FT   CDS_pept        complement(127443..128390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0133"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   transposase IS111A/IS1328/IS1533; KEGG: hne:HNE_3446
FT                   ISHne3, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54444"
FT                   /db_xref="GOA:C6AZB8"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZB8"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ACS54444.1"
FT                   /translation="MHIQQSFMVGIDVSKAHLDVAVEGKRAVVRFDNNAPGCAALTAAV
FT                   AGAELVVVEATGGYEMAIVRTLMAAGIAVAVVNPRQVRDFARASGRLAKTDQVDARVTL
FT                   HFARAMRPAQIPHIDDGRIALAALVTRRRQLIDMAVAEKNRLEHAPEAVAALIGETLAA
FT                   LRAQLARVDAAIALAIEAEPDMAARRNLLLTVPGIGEVSAAVLIAELPELGAIDDKKLA
FT                   ALVGVAPIAHDSGTWRGQRHIAGGRATVRCALYMATLSAIRCNPAIKTFHKRLRDAGKP
FT                   PKVAIVAAMRKLIIMINTILKRRTPWNQPQQHGC"
     atgcatatcc agcaatcttt catggtcggt atcgatgtct cgaaggccca tctcgacgtt        60
     gccgttgagg gcaaacgcgc cgttgtccgc ttcgacaaca atgcgccagg ctgtgccgca       120
     ctcactgcgg cagtggccgg cgcagagctt gtcgtcgtcg aggcgaccgg cggttacgag       180
     atggcaatcg tcagaacgct tatggccgcc ggtattgccg tcgccgtcgt caatccccgc       240
     caggtgcgcg acttcgccag ggccagcggt cgtttggcca agaccgatca ggtcgacgcc       300
     cgcgtcacgc tccacttcgc cagagcgatg cggccggcac agatccccca tatcgacgac       360
     ggccgcatcg cgcttgctgc gcttgtcacc cgccgtcgcc aactcatcga catggcggtc       420
     gccgagaaga accgcctcga gcatgcgcct gaggccgtcg cagcgctgat tggcgagacc       480
     ctcgccgccc tcagggctca gctcgcccgc gtcgatgccg ccatcgcgct cgccatcgag       540
     gccgagcccg acatggccgc acgccgcaat ctgctgctga ccgtgccggg cattggcgag       600
     gtcagtgccg ccgtgctcat cgccgaactg cccgaactcg gcgccatcga cgacaagaag       660
     ctcgcagccc tcgtcggcgt cgcccccatc gctcacgaca gcggcacatg gcgtggacaa       720
     cgccatatcg ccggcggccg cgccaccgtc cgatgcgccc tctatatggc tacgctctcg       780
     gccatccgtt gcaacccggc catcaagacc ttccacaaaa ggctgcgcga cgcgggcaaa       840
     ccgcccaagg tcgccatcgt cgccgccatg cgaaagctca tcatcatgat caacactatt       900
     cttaaaagac gaaccccatg gaaccagccc caacaacacg gttgctga                    948
//

If you have problems or comments...

PBIL Back to PBIL home page