(data stored in ACNUC7421 zone)

EMBL: CP001622.PE133

CP001622.PE133       Location/Qualifiers
FT   CDS_pept        complement(128895..129524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0134"
FT                   /product="Glutathione S-transferase domain protein"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   mlo:mlr2042 glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54445"
FT                   /db_xref="GOA:C6AZB9"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZB9"
FT                   /inference="protein motif:PFAM:PF00043"
FT                   /protein_id="ACS54445.1"
FT                   /translation="MFTLHDYLPSQNGWKVRVLLGLLDMPYHSRIVSIFEGENRTETFL
FT                   ELNPVGAIPVLELDDGRAIAESNAILTFLAEGTRFLPSDHYLRAKVMQWLFFEQYHVEP
FT                   VIGSLRFWTLTGRLERNQSMVAGKREAAARALAAIDRRLTDSLFLVGQQLTIADIAVYA
FT                   YSHRAEDCGFSLAAYPTFSAWSGRVRDAIGADHPVYPYSMDPHSAG"
     atgtttacgc ttcacgatta tctgccgtcg caaaatggct ggaaggtccg ggttttgctc        60
     ggcctgctcg acatgcccta tcacagccgt atcgtctcga tcttcgaggg cgagaaccgc       120
     accgagacgt tcctggaact caatccggtg ggcgccatcc cggttctcga actcgacgat       180
     ggtcgtgcga tcgccgaatc caatgcgatc ctcacttttc ttgccgaggg cacgcgcttc       240
     ttgccgtcag atcactatct gcgcgccaag gtcatgcaat ggctgttctt cgaacagtat       300
     catgtcgagc cggtcatcgg ctcgctgcgc ttctggacgt tgacgggacg gctggagcgt       360
     aaccagagca tggtcgcggg caagcgcgaa gccgcagccc gcgcgcttgc cgccatcgat       420
     cgcaggctga ccgacagcct gtttcttgtc ggccagcagc tgacgatcgc ggatatcgcg       480
     gtttacgcct atagccaccg ggccgaggat tgcggctttt ctctcgcagc ctatcctacg       540
     ttttctgcct ggtccggccg cgttcgggat gccatcggcg ccgatcatcc ggtctatccc       600
     tatagtatgg acccacattc ggccggctaa                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page