(data stored in ACNUC7421 zone)

EMBL: CP001622.PE134

CP001622.PE134       Location/Qualifiers
FT   CDS_pept        complement(129622..130104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0135"
FT                   /product="conserved hypothetical conserved membrane
FT                   protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000543 hypothetical conserved
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54446"
FT                   /db_xref="GOA:C6AZC0"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZC0"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000543"
FT                   /protein_id="ACS54446.1"
FT                   /translation="MQIFLTLFLVAAAIGSGLVAGIFFAFSTFIMTAFSRIPAEQGIAA
FT                   MNSINVTIVRSPFMGLFVPTAILCLVIAVLALIDWRGGASFLMLAGAALYIFASFLSTI
FT                   IFNVPMNDALAKVGGNGPEAVQLWATYVRDWTRWNHVRTIASLLASVAFVRALMIV"
     atgcagatct ttctcaccct tttcctcgtg gccgcggcga tcggcagcgg cctcgtcgcc        60
     ggcatcttct ttgccttctc gaccttcatc atgaccgcct tctcgcggat cccggcggag       120
     caaggcattg cggcgatgaa ctcgatcaac gtgacgatcg tccgctcgcc cttcatgggc       180
     ctcttcgtgc cgacggcgat cctctgcctc gtcatcgccg tgctcgccct gatcgactgg       240
     cgcggcgggg catcctttct gatgctggcg ggtgcagctc tctacatctt cgcctctttc       300
     ctctcgacca tcatcttcaa cgtgccgatg aacgatgcgc tggcaaaggt cggcggcaat       360
     gggccggaag cggttcagct ctgggccacc tatgtcaggg actggacgcg gtggaaccat       420
     gtgcggacca tcgcctcgct actcgcctcg gtcgccttcg tgcgggcgtt gatgatcgtc       480
     tga                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page