(data stored in ACNUC7421 zone)

EMBL: CP001622.PE135

CP001622.PE135       Location/Qualifiers
FT   CDS_pept        complement(130107..130931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0136"
FT                   /product="NmrA family protein"
FT                   /note="PFAM: NmrA family protein; dTDP-4-dehydrorhamnose
FT                   reductase; KEGG: rpd:RPD_2341 NmrA-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54447"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZC1"
FT                   /inference="protein motif:PFAM:PF05368"
FT                   /protein_id="ACS54447.1"
FT                   /translation="MQTSEIVLVGGSGKTGSRIIKRLEARGLTVRAASRSSARPFDWED
FT                   RSTWRGALEGASSAYVAFQPDLSVAWAAEAIEALARVAVECGLEHIVLLSGRGEEGAQR
FT                   SEAALKASGINTTILRASWFCQNFSEGAFVEQIIGGRLQLPAGEISEPFIDADDIADAA
FT                   VAALTDPGHRNKTYELTGPRALTFRQAVAEIAQAAGRPIEYEQVSMADFTGGLADAGLP
FT                   QGLIDLLEELFSQVLDGRNSGTMGGVAEILGRPATDFSECARRTAATGLWSA"
     atgcagactt ccgaaatcgt cctcgttggt ggatcgggaa agaccggcag ccgcatcatc        60
     aagcgtctgg aagcgcgcgg cctcaccgtt cgtgcggcat cacgctccag cgcacggccc       120
     ttcgactggg aggacaggtc gacctggcgc ggcgcgcttg agggcgcatc gagcgcctat       180
     gtcgccttcc agccggacct ttccgtcgcc tgggcggcgg aagcgatcga agcgctcgcc       240
     agggtcgctg tggaatgcgg ccttgagcat atcgtgctgc tttccggccg cggcgaagag       300
     ggcgcgcagc gaagcgaagc ggcgctgaaa gcttccggca taaacaccac catcctgcgc       360
     gcctcctggt tctgccagaa cttcagcgag ggcgcctttg tcgagcagat cattggcggc       420
     cggctgcaat tgccggcagg cgagatcagc gaacctttca tcgatgccga cgacatcgcc       480
     gatgccgccg tcgccgcctt gaccgatccc ggccatcgca acaagactta cgaactgacc       540
     ggcccgcggg cgctgacatt ccgtcaggcg gtcgccgaga tcgcccaggc cgccgggcgg       600
     ccgatcgaat atgagcaggt gtcgatggcg gatttcaccg gcgggcttgc ggatgccggc       660
     ctgccgcagg gcctgatcga tcttctggag gagcttttca gccaggtgct cgatgggcgc       720
     aattccggca ccatgggcgg tgtcgccgaa attctcggcc gtcccgccac cgatttcagc       780
     gaatgtgccc gccggaccgc ggcaaccgga ctatggagcg cctga                       825
//

If you have problems or comments...

PBIL Back to PBIL home page