(data stored in ACNUC7421 zone)

EMBL: CP001622.PE136

CP001622.PE136       Location/Qualifiers
FT   CDS_pept        131033..131686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0137"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: ret:RHE_CH00473
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54448"
FT                   /db_xref="GOA:C6AZC2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041674"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZC2"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACS54448.1"
FT                   /translation="MSEQPVATRRRQQESTGQLRRIPSQQRGRERFEKILTVAAELIES
FT                   HGSDGLKMSEIVEKAGLSFGALYQYFPDKTSIIRTLAERFNEEGRRCVEEELAKVTDAA
FT                   ALQGALANIVDEYYAFFRREPVMRDIWHATHTDKLLQQVDAVDMEFHAQAFLAVLIRLW
FT                   PDRDRRELLVIARLTMQLLAAAVRYAVSLDAEEGAQAIALFKKMQIVDIGSLLQ"
     atgtcggaac agccggtcgc aacgcgcagg cgccagcagg agtctaccgg ccagctgcgc        60
     cgcatcccca gccagcagcg tggccgcgag cgcttcgaaa agatcctcac cgtggccgcc       120
     gagctgatcg aaagccatgg cagcgacggc ctgaagatga gcgagatcgt cgaaaaggcc       180
     ggcctttcct tcggcgccct ctaccaatat ttccccgaca agacctcgat catccgcaca       240
     ttggccgagc gcttcaacga agagggcagg cggtgtgtcg aagaggagct ggcgaaggtg       300
     accgacgctg cggccctgca gggcgcgctc gctaatatcg tcgacgaata ttacgccttc       360
     ttccgccgcg agcctgtcat gcgcgacatc tggcatgcga cccataccga caagctgctg       420
     caacaggtcg atgccgtgga catggaattt catgcccagg catttctcgc cgtgcttatc       480
     cgtctatggc cggatcgcga ccgcagggag ttgctcgtga tcgcccggct gacgatgcag       540
     ttgcttgccg ccgccgtgcg ttatgccgtt tcgctggatg cggaggaggg cgcccaggcg       600
     atcgccctgt tcaagaagat gcagatcgtt gatatcggca gtctgctgca atag             654
//

If you have problems or comments...

PBIL Back to PBIL home page