(data stored in ACNUC7421 zone)

EMBL: CP001622.PE137

CP001622.PE137       Location/Qualifiers
FT   CDS_pept        131759..132448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0138"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="KEGG: ret:RHE_CH00474 orotate
FT                   phosphoribosyltransferase; TIGRFAM: orotate
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54449"
FT                   /db_xref="GOA:C6AZC3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZC3"
FT                   /inference="protein motif:TFAM:TIGR00336"
FT                   /protein_id="ACS54449.1"
FT                   /translation="MIQTTFPDRAVMAELLAKMLWEIKAVHFNAAQPYKLSSGMASPVY
FT                   IDCRKLLSFPRIRSTVMDFAASILLRDAGFEQFDCIAGGETAGIPFAALLADRLGLPMI
FT                   YVRKQPKGHGRNAQIEGNMPEGSRVLVIEDLTTAGGSMFKFIDAVRAAGGIVDHGIALF
FT                   FYGIFGEQRFADGKVRLHHIATWRNVLAVAKEQKLFDDKTLSEVEAFLDAPLAWSGRNG
FT                   GVSELSL"
     atgatccaga ccacatttcc cgaccgcgcc gtgatggctg aattgctggc caagatgctc        60
     tgggaaatca aggcggtgca tttcaatgcc gcccagccct ataaactctc ctccggcatg       120
     gcgagcccgg tctatatcga ttgccgcaag ctgctctcct tcccgcgcat ccgctcgacg       180
     gtgatggatt tcgccgccag catcctgttg cgcgatgccg gcttcgagca gttcgattgc       240
     atcgccggcg gcgagaccgc cggcattccc ttcgccgccc tgcttgccga tcgtctcggc       300
     ctgccgatga tctatgtccg caagcagccg aagggccatg gccgcaatgc ccagatcgaa       360
     ggcaatatgc cggaaggctc gcgcgtgctc gtcattgaag acctgacgac agcaggcggc       420
     agcatgttca agttcatcga tgccgtccgt gccgctggcg gcatcgtcga tcacggcatc       480
     gcgctgttct tctacggcat attcggcgaa cagcgctttg ccgacggcaa ggtcaggctg       540
     catcacatcg ccacctggcg taatgttctg gccgttgcca aggagcagaa gctcttcgac       600
     gacaagacgc tctcggaagt cgaggccttc ctcgatgcgc cgctcgcctg gtcgggaagg       660
     aatggcgggg tgagtgagct ttcgctctag                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page