(data stored in ACNUC7421 zone)

EMBL: CP001622.PE138

CP001622.PE138       Location/Qualifiers
FT   CDS_pept        132510..133436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0139"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG:
FT                   rec:RHECIAT_CH0000546 fructokinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54450"
FT                   /db_xref="GOA:C6AZC4"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZC4"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ACS54450.1"
FT                   /translation="MILCCGEALIDMLPRDTTLGEKGFAPYAGGAIFNTAIALGRLGIP
FT                   TAFFTGIADDMMGEILLETLKASNVDYSPCAITPHPSTIAFVKLVNGQATYAFYDEGTA
FT                   GRMITTADLPDLGDDCEALHFGAISLIPSPCGETYEALLDREAARRVISLDPNIRPGFI
FT                   KDKPSHMARIKRMAAKADIVKFSDEDLEWFGLQGDHDALAAHWLNHGAKLVVITKGAEG
FT                   ASGYTKERKVTVPSERVTVVDTVGAGDTFDAGILASLKMDNLLTKRQVASLDEQALRNA
FT                   LTLGAKAAAVTVSRAGANPPWAREIGL"
     atgattttgt gctgcggcga agccttgatc gacatgctgc cgagggacac gacgctgggc        60
     gaaaagggct ttgcgcccta tgccggcggc gcaatcttca acaccgcaat cgcgctcggt       120
     cgcctcggta tccccacggc cttcttcacc ggcattgccg atgacatgat gggcgaaatc       180
     ctgctcgaga cgctgaaggc gagcaatgtc gattacagcc catgcgccat cacgccgcat       240
     ccctcgacca tcgccttcgt caagctggtc aacggccagg cgacctatgc cttctacgat       300
     gagggcacgg ccggccggat gatcaccacg gccgacctgc cggatctcgg cgacgattgt       360
     gaagcactgc acttcggcgc gatcagcctg atccccagcc cctgcggcga aacctacgaa       420
     gccctgctcg accgcgaagc cgctcgccgc gtcatctcgc tcgatccgaa tatccgtccc       480
     ggtttcatca aggacaagcc gtcgcatatg gcccgcatca agcgcatggc tgcgaaagcc       540
     gacatcgtca aattctccga cgaggatctc gaatggttcg gtctgcaggg cgaccatgat       600
     gcgctcgccg cccattggct gaaccacggc gccaagctcg tcgtcatcac caagggcgcg       660
     gaaggcgctt ccggttatac caaggagcgc aaggtaacag tgccgagcga gcgcgtcacc       720
     gtcgtcgaca cggtcggcgc cggcgatacc ttcgatgccg gcatcctggc gtcgctgaag       780
     atggataatc tgctgaccaa gcgccaagtc gcctcgctgg atgagcaggc gctgcgcaac       840
     gccctgaccc tcggcgccaa agccgccgcc gtcaccgtct cccgcgccgg cgccaatccg       900
     ccctgggcgc gcgagatcgg tctttaa                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page