(data stored in ACNUC7421 zone)

EMBL: CP001622.PE139

CP001622.PE139       Location/Qualifiers
FT   CDS_pept        complement(133611..134018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0140"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; Helix-turn-helix type
FT                   11 domain protein; SMART: regulatory protein ArsR; KEGG:
FT                   ret:RHE_CH00427 ArsR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54451"
FT                   /db_xref="GOA:C6AZC5"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZC5"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ACS54451.1"
FT                   /translation="MMQQARRPDLDEETFDDAVEGRSVSAAQRVFHALSSAPRRKILAY
FT                   LSASGLTAGEIADRFSMSKPAVSQHLSILEAAGLIRREKQGQFVHYSLIENNLVNTLNG
FT                   FVQEVCPVGRPIKKESQARTRGGLVPAKPAK"
     atgatgcagc aggcacggag accggacttg gacgaagaga ctttcgatga cgctgtagaa        60
     ggccgctccg tcagcgccgc ccagcgggta ttccacgcgc tttccagtgc gccgcgccgg       120
     aagatcctcg cctatctctc ggcatcgggt ctgaccgctg gcgagatcgc tgaccgcttc       180
     agcatgtcca agccagccgt ttcgcagcat ctttccatcc tcgaagctgc gggtctgatc       240
     agacgagaga aacagggcca gttcgtccac tattccctga tcgagaacaa tctcgtcaac       300
     acgctcaacg gcttcgtgca ggaggtctgc ccggtcggtc ggccgatcaa gaaggaaagt       360
     caggcgcgca cccggggcgg attggtgccg gcgaagcccg cgaaataa                    408
//

If you have problems or comments...

PBIL Back to PBIL home page