(data stored in ACNUC7421 zone)

EMBL: CP001622.PE14

CP001622.PE14        Location/Qualifiers
FT   CDS_pept        complement(11244..11945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0014"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /note="PFAM: putative methyltransferase; KEGG:
FT                   rec:RHECIAT_CH0000409 probable tRNA
FT                   (guanine-N(7)-)-methyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54326"
FT                   /db_xref="GOA:C6AYA2"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYA2"
FT                   /inference="protein motif:PRIAM:2.1.1.33"
FT                   /protein_id="ACS54326.1"
FT                   /translation="MTDMERRGRATEAFFGRRKGKALREQQAETLNSLLPAFLIDLTAA
FT                   PPEPLTSLFPVPVERLRLEIGFGGGEHLIHRALNTPSTGFIGVEPFVNSMQKLLSRIGE
FT                   TGASNIRVYNDDATQLLDWLPDGSLDQVDLLYPDPWPKRKHWKRRFVSKTNLDRFHRVL
FT                   KPGGLFCFASDIDTYVNWTLIKCRDHGGFDWMADNAADWLTPYEGWPSTRYEAKARREG
FT                   RSSAYLTFRKI"
     atgacggata tggaacgccg cggccgggcg accgaagcct tcttcggtcg tcgcaagggc        60
     aaggccctgc gcgaacagca ggccgagacg ctaaacagtc tcctgccggc attcctgatc       120
     gatcttacag cggctccccc ggagccgctg acatccctct ttccggttcc ggtcgaaaga       180
     ttgcggctgg aaatcggttt cggcggcggc gagcacctga tccaccgcgc gctgaacacg       240
     ccttcgaccg gcttcatcgg tgtcgaaccc ttcgtcaatt ccatgcagaa gctgctgtcg       300
     cgcatcggcg agaccggtgc ctccaatatc cgcgtttata atgacgacgc gacgcagctg       360
     ctcgattggc tgccggacgg ctcactcgat caggtcgatc tgctctatcc tgatccctgg       420
     ccgaagcgga agcactggaa gcgacgtttc gtctcgaaaa ccaatctcga ccgctttcat       480
     cgcgtgctga agcccggcgg cctgttctgc ttcgcctccg acatcgatac ctatgtgaac       540
     tggacgctaa tcaaatgccg cgaccatggc ggtttcgact ggatggccga caatgcagcc       600
     gattggctga ccccctatga gggctggccg agcacacgtt acgaggccaa ggcgcggcgc       660
     gaggggcggt cctcggccta tctgaccttc aggaagatct ga                          702
//

If you have problems or comments...

PBIL Back to PBIL home page