(data stored in ACNUC7421 zone)

EMBL: CP001622.PE140

CP001622.PE140       Location/Qualifiers
FT   CDS_pept        134161..135123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0141"
FT                   /product="fatty acid desaturase"
FT                   /note="PFAM: fatty acid desaturase; KEGG: ret:RHE_CH00426
FT                   fatty acid desaturase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54452"
FT                   /db_xref="GOA:C6AZC6"
FT                   /db_xref="InterPro:IPR015876"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZC6"
FT                   /inference="protein motif:PFAM:PF00487"
FT                   /protein_id="ACS54452.1"
FT                   /translation="MSSISTGRMIDNSSDAVKGRVVWMPAKSIWITAMTLIAVIGGPLT
FT                   FTWSAFAVFILLTAITICLGHSVGMHRLLIHRSFSTHTWIEHFLVYLGTVVGMAGPFGM
FT                   IYAHDIRDWAQRQRDCHDLYAHRRSFFIDAFWQMHCIVALDHPPRFVLEERERRDRFYR
FT                   FLEATWMAQQIPLGLALFALGGLPWVVWGIAVRISVSLTGHWLVGHFAHRDGHQGWSVD
FT                   DVAVQGYNLPRFGLVTFGESFHGNHHAFPDSARLGIEPGQLDLGWYFIGLLARLGLASA
FT                   IKLPHTIVPRRGLRRVNATETAGDSHPPHHAAGHAESRP"
     atgagcagta tttccactgg acgaatgatt gacaacagca gcgatgcggt gaagggcaga        60
     gtggtctgga tgcccgcaaa gtcgatctgg atcaccgcca tgaccttgat tgccgtcatt       120
     ggtggtccac tgaccttcac ctggagcgcc tttgccgtct ttatcctctt gaccgccatc       180
     acgatctgcc ttggtcattc ggtcggcatg caccggctgc tgatccatcg ctcattcagc       240
     actcatacct ggatcgagca ctttctcgtc tatctcggta cggtggtcgg catggccggc       300
     cccttcggta tgatctacgc gcacgacatt cgcgactggg cgcaacggca gcgagactgc       360
     catgacctct atgcccatcg gcggtctttc ttcatcgatg ccttctggca gatgcattgc       420
     atcgtggcgc tggaccatcc gccgcgtttc gtcctcgagg agcgcgagcg gcgcgaccgc       480
     ttctatcgtt ttctggaggc gacatggatg gcgcagcaga ttcccttggg actcgcgctc       540
     tttgcgctcg gcggactgcc atgggtggtc tggggtattg ccgtgcggat atcggtgtcg       600
     ctgaccggac actggctggt cggccatttc gcgcatcgag acggccatca gggctggagt       660
     gtcgatgatg tcgcggtaca gggctataac ctcccgcgtt tcgggctggt gaccttcggc       720
     gagagcttcc acggcaatca tcacgccttt ccggattcgg cgcggctcgg catcgagccg       780
     gggcagctgg atctcggttg gtatttcatc gggctgctgg caaggctcgg tctggcttcg       840
     gcgatcaagc tgccacatac gatcgtgcca aggcgagggt tgagacgcgt caacgcaact       900
     gaaacggcgg gcgacagtca tccgccacat cacgcagcag gtcacgcgga atctcgcccg       960
     taa                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page