(data stored in ACNUC7421 zone)

EMBL: CP001622.PE141

CP001622.PE141       Location/Qualifiers
FT   CDS_pept        complement(135199..136614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0142"
FT                   /product="alpha,alpha-trehalose-phosphate synthase
FT                   (UDP-forming)"
FT                   /EC_number="2.4.1.15"
FT                   /note="KEGG: ret:RHE_CH00476 trehalose-6-phosphate synthase
FT                   protein; TIGRFAM: alpha,alpha-trehalose-phosphate synthase
FT                   [UDP-forming]; PFAM: glycosyl transferase family 20"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54453"
FT                   /db_xref="GOA:C6AZC7"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="InterPro:IPR012766"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZC7"
FT                   /inference="protein motif:TFAM:TIGR02400"
FT                   /protein_id="ACS54453.1"
FT                   /translation="MSRLVVVSNRVPMPAKDGSAAAGGLAVALQAALQERGGIWMGWSG
FT                   ESSGDREPGPLSQLQKGNITYALTDLTDTDVEEYYRGFANRVLWPICHYRLDLAEYGRK
FT                   EMAGYFRVNRFFAHRLAPMIEPDDIIWVHDYHLIPLAAELRQMGLKNRIGFFLHIPWPP
FT                   ADILVTMPVHEEIMRGLSHYDLVGFQTDYDLQNFAGYLRREGIGDDLGNGLFDSHGRIF
FT                   KAGAYPIGIETAAFAEFAERAANNIMVQKTRRSVEGRDMIIGVDRLDYSKGIIQRLEAF
FT                   ETFLTSNPAYQNKVTYLQVTPKSRSEVPEYEHMQGMVAEQAGRVNGAIGTVDWVPIRYV
FT                   NRSISRNVLAGLYRLATIGLVTPLRDGMNLVAKEYVAAQDPDRPGVLVLSRFAGAAREL
FT                   KGALLVNPYDVEGTANAIAKGLAMSLEERRDRWSMMMEHLLTHDVSLWCENFLGDLVLA
FT                   PELRPERDSRIGS"
     atgagccgtc ttgtcgtcgt ttccaatcgt gttcccatgc cggccaaaga tgggagcgcc        60
     gctgccggcg gcctggccgt cgcgctgcag gcagccctgc aggagcgagg cggcatctgg       120
     atgggatggt cgggagaatc gagcggggac agggaacctg gcccgctgtc acagctgcag       180
     aagggcaaca tcacctatgc gctgaccgat ctcaccgaca ccgacgtcga ggaatattat       240
     cgcggcttcg caaaccgggt tctctggccc atctgccatt accgcctgga cctcgccgaa       300
     tatggccgga aggaaatggc cggctatttc cgcgtcaacc gcttcttcgc ccacaggttg       360
     gcgccgatga tcgagccgga cgacatcatc tgggttcatg attaccacct cattccgctg       420
     gcggccgaac tgcgccaaat ggggctgaaa aaccggatcg gcttcttcct gcacattccc       480
     tggccgccgg ccgacattct cgtcacgatg cccgtccatg aggaaatcat gcgcgggctc       540
     tcgcattacg atctcgtcgg cttccagacc gactacgacc tccagaactt tgccgggtat       600
     ctcagaaggg agggaattgg cgacgacctc ggaaatggat tgttcgattc ccatgggcgg       660
     atattcaagg ccggcgccta tccgatcggg atcgaaactg ctgccttcgc cgaattcgcc       720
     gagagagccg caaacaatat catggtacag aagacccggc gcagcgttga aggccgggac       780
     atgatcatcg gggtcgaccg cctcgattat tcgaagggca tcattcagcg gctggaagcg       840
     ttcgaaacct tcctcaccag caatcctgcc taccagaaca aggtcaccta tctgcaggtc       900
     acgccaaaat cgcgatcgga agttcccgaa tacgagcata tgcaggggat ggtcgccgaa       960
     caggccggcc gtgtcaacgg cgccatcgga acggtcgact gggtgccgat ccgctatgtc      1020
     aaccgatcga tcagccgcaa cgtgcttgcc ggcctctacc ggctggcgac gatcgggctg      1080
     gtcacgccgt tgcgcgacgg catgaacctc gtcgccaagg aatatgtcgc cgcccaggac      1140
     ccggatcgcc cgggcgtatt ggtgctatcg cgcttcgccg gtgcggctcg cgagttgaag      1200
     ggcgcactgc tggtcaatcc ttacgatgtc gaaggcactg ccaatgccat cgccaagggc      1260
     cttgccatgt cgctggagga gcgccgcgac cgctggagca tgatgatgga gcatctgcta      1320
     acccacgacg tctcgctttg gtgcgaaaac ttcttggggg atctcgtgct tgctcccgag      1380
     cttcgaccgg agcgtgactc ccggataggc tcctga                                1416
//

If you have problems or comments...

PBIL Back to PBIL home page