(data stored in ACNUC7421 zone)

EMBL: CP001622.PE142

CP001622.PE142       Location/Qualifiers
FT   CDS_pept        complement(137195..138820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0143"
FT                   /product="Glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /note="PFAM: phosphoglucose isomerase (PGI); KEGG:
FT                   rec:RHECIAT_CH0000548 glucose-6-phosphate isomerase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54454"
FT                   /db_xref="GOA:C6AZC8"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZC8"
FT                   /inference="protein motif:PRIAM:5.3.1.9"
FT                   /protein_id="ACS54454.1"
FT                   /translation="MNAIVEQLKSTADATKATDIRAAFATDSQRFSRFSVALDDLLMDF
FT                   SKTAVNDDILKLLVKLAEDGGVETKREEMFSGKAINFTEDRAVLHTALRNRSNTPVLVD
FT                   GKDVMPDVNAVLAAMGKFADDVRSGTLKGATGKAITDVINIGIGGSDLGPVMATLALAP
FT                   FHDGPRAHFVSNIDGAHIADILKLVQPETTLFIVASKTFTTVETMTNAQTARNFIAKAL
FT                   GEAAVQHHFAAVSTALDKVAAFGIDSARVFGFWDWVGGRYSIWSAIGLPLMIAVGPENF
FT                   GKFLDGAHAVDNHFRKAPITENLPVLLGLIGFYHRNVLGYPTRAILPYDQRLSRFPAYL
FT                   QQLDMESNGKGVTIDGTPVEGNSGPVVWGEPGTNGQHAFYQLIHQGTSIIPAEFMIAAN
FT                   AFEPELRHQHQLLISNVLAQSEALMKGRTFAEAKKQLTDKGMDDKKADFIAPHRVFTGN
FT                   RPSITFVYDKLTPYALGRLIALYEHRVFVEGVLFRINSFDQWGVELGKELATGLLPVVE
FT                   GKESAAAHDSSTQGLVAALAKLAK"
     atgaacgcca tcgtcgaaca gctgaaaagc accgctgatg ccaccaaggc aaccgatatc        60
     cgtgccgcct tcgccaccga ttcgcagcgc ttttcgcgct tttccgtcgc gcttgacgac       120
     ctgctgatgg atttttccaa gacggcggtg aatgacgaca tcctcaagct cctggtgaag       180
     cttgccgaag acggcggcgt cgagacgaag cgcgaggaaa tgttctccgg caaggcgatc       240
     aacttcaccg aggatcgcgc cgttctgcac acagcgctgc gcaaccgttc caacacgccg       300
     gtgctggtcg acggcaagga cgtcatgccc gacgtcaatg cggtgcttgc cgccatgggc       360
     aagtttgccg acgacgtccg ctccggcacg ctgaagggcg cgaccggcaa ggcgatcacc       420
     gatgtcatca atatcggcat cggcggctcg gatctcgggc ctgtcatggc gacgctggcg       480
     cttgccccct tccatgacgg tccgcgcgcg catttcgtct ccaacatcga cggcgcccat       540
     atcgccgata tcctgaagct ggtgcagccg gaaacgacgc tgttcatcgt cgcctcgaag       600
     accttcacca ccgtcgagac gatgaccaat gcgcagacgg cgcgcaattt catcgccaag       660
     gcgctcggcg aagccgccgt gcagcaccac ttcgctgccg tctcgacggc gctcgacaag       720
     gtcgccgcct tcggcatcga cagcgcccgc gtcttcggct tctgggactg ggtcggcggc       780
     cgttactcga tctggtcggc gatcggcctg ccgctgatga tcgcagtcgg ccctgagaat       840
     ttcggcaagt tcctcgacgg agcccacgcc gtcgacaatc atttccgtaa ggcgccgatt       900
     accgaaaacc tgcctgtgct gctcggcctg atcggcttct accatcgcaa tgtgctgggc       960
     taccccaccc gcgccatcct gccctacgac cagcgcctgt cgcgtttccc ggcctatctg      1020
     cagcagctcg acatggaatc gaacggcaag ggcgtcacca tcgacggcac gccggtcgaa      1080
     ggcaattccg gccccgtcgt ctggggcgag cccggcacca acggccagca cgccttctac      1140
     cagctcatcc atcagggcac gagcatcatc cccgcggagt tcatgatcgc tgccaacgcc      1200
     ttcgagccgg agctgcgcca ccagcaccag ctgctgatct ccaacgttct cgcccaatcg      1260
     gaagcgctga tgaaggggcg caccttcgca gaagccaaga agcagctgac cgacaagggc      1320
     atggacgaca aaaaggccga tttcatcgcg ccgcaccgcg tcttcaccgg caaccggccg      1380
     tcaatcacct tcgtctacga caagctgacg ccctatgcgc tcggccggct gatcgcgctt      1440
     tacgaacatc gcgtcttcgt cgaaggcgtg ctcttccgca tcaactcctt cgaccagtgg      1500
     ggcgtcgagc tcggcaagga actggcaacg ggtctgctgc ctgtcgtcga aggcaaggaa      1560
     agtgcggccg cgcatgactc ttcgacgcag ggcctggttg cggcactggc gaagctggcg      1620
     aagtaa                                                                 1626
//

If you have problems or comments...

PBIL Back to PBIL home page