(data stored in ACNUC7421 zone)

EMBL: CP001622.PE143

CP001622.PE143       Location/Qualifiers
FT   CDS_pept        complement(138972..140672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0144"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   rec:RHECIAT_CH0000549 long-chain-fatty-acid-CoA ligase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54455"
FT                   /db_xref="GOA:C6AZC9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZC9"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACS54455.1"
FT                   /translation="MNSISVHPNGAKPDKPWLAAYPDIVPAEIPPLEYVSLAELLEKSC
FT                   ARYADRTAFSSMGKGMRYRELESQTRKLAAWLQSTGLQKGDRVAVMMPNVLQNPIATYA
FT                   ILRAGLVVVNVNPLYTPRELEHQLKDSGAKAIFVLENFARTVEQVLNKTDLRHVVVTSL
FT                   GEMLGPKGLIVNFVVRKVKKLVPSWSIPQHKSFGQVLSEGAGKKLQPVALTGSDIAFLQ
FT                   YTGGTTGVAKGAMLTHQNLLANKAQLSLWLRSAFERKKEPEVLNFLCALPLYHIFALTV
FT                   NSLMGMSLGAHNILIANPRDIPGLVKEFEKSKVHIFPGLNTLFNALMNNADFAKLDFSS
FT                   LIMSLGGGMAVQRPVADRWLKMTGTAVTEGYGLSETSPVATANRFDSPEFTGTIGLPLP
FT                   STELDIRDEAGNSLPLGDVGEICIRGPQVMAGYWQKPEETARVMTDDGYFRSGDMGFMD
FT                   DRGYTKIVDRKKDMILVSGFNVYPNEIEEVAAMHAGILEAAAIGVPDGHSGEAVKLFVV
FT                   RKDPNLTEAEVKAHCIANLTNYKRPRFIEFRTELPKSPVGKILRKDLRG"
     atgaacagca tttccgtcca tccgaacgga gccaagcccg acaagccctg gcttgccgct        60
     tatcccgata tcgttccggc agagattccg ccgctggaat atgtctcgct tgccgaactg       120
     ctggaaaaat cttgcgcccg ttatgccgac cggaccgcct tttccagcat gggcaagggg       180
     atgcgctacc gcgagctgga gagccagacg cgcaaactcg ccgcctggct gcaaagcacc       240
     ggccttcaga agggcgaccg cgtcgccgtg atgatgccga acgtgctgca gaacccgatt       300
     gccacctatg ccatcctgcg cgccggcctt gtcgtcgtga acgtcaaccc gctctatacg       360
     ccgcgcgagc tcgaacatca gttgaaggat tccggcgcca aggcgatctt cgtgctggag       420
     aatttcgcac gcacggtgga acaggttctc aacaagacgg atctccgcca tgtcgtcgtc       480
     acctcgctcg gggaaatgct ggggccgaag gggctgatcg tcaatttcgt cgtgcgcaag       540
     gtgaagaagc tcgttccctc ctggtcgatc cctcagcaca agagcttcgg ccaggtgctt       600
     agcgaaggtg cgggaaaaaa gctccagccg gtcgcgctga caggcagcga catcgccttc       660
     ctgcaatata ccggcggcac gacgggcgtt gccaagggcg cgatgctgac acatcagaac       720
     ctgctcgcca acaaggcgca gctgtcgctc tggcttcgat cggccttcga gcgcaagaaa       780
     gagccggagg tgctgaactt cctctgcgcc ctgccgctct accacatctt cgcgctgacg       840
     gtgaattcgc tgatgggcat gtcgctcggc gcccacaata tcctgatcgc caatccgcgc       900
     gacattcccg gtctcgtcaa ggaattcgaa aagtcgaagg tgcatatctt ccccggcctc       960
     aacacgctgt tcaatgcgct gatgaacaat gccgatttcg ccaagctcga cttctcctcg      1020
     ctgatcatgt cgctcggcgg cggcatggcc gtgcagcgcc cggtcgccga ccgctggctg      1080
     aagatgacgg gcacggcggt gacggaaggc tacggccttt ccgagacatc gcccgttgcc      1140
     accgccaacc gcttcgattc gcctgagttc accggcacga tcggtctgcc gcttccctcc      1200
     accgaactcg acatccgcga cgaagctggc aattcgctac cgctcggcga cgtcggcgag      1260
     atctgcatcc gcgggccgca ggtgatggcc ggctactggc agaagccgga ggagacggcg      1320
     cgggtgatga ccgatgacgg ctatttccgc tcgggcgaca tgggcttcat ggacgaccgc      1380
     ggctatacca agatcgtcga ccgcaagaag gacatgatcc tcgtctccgg cttcaacgtc      1440
     tatccgaacg agatcgagga agtcgctgcc atgcatgccg gcatcctcga ggccgcagcc      1500
     atcggcgtgc cggacggaca ttcgggcgag gcggtaaaac tcttcgtcgt caggaaggat      1560
     ccgaacctga cggaagccga ggtaaaagcc cattgcatcg ccaacctcac caactacaaa      1620
     cgcccgcgct tcatcgaatt ccgcaccgag ctgccgaagt cgcctgttgg taagatcctg      1680
     cgcaaggacc tgcgcggctg a                                                1701
//

If you have problems or comments...

PBIL Back to PBIL home page