(data stored in ACNUC7421 zone)

EMBL: CP001622.PE144

CP001622.PE144       Location/Qualifiers
FT   CDS_pept        140918..141310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0145"
FT                   /product="PRC-barrel domain protein"
FT                   /note="PFAM: PRC-barrel domain protein; KEGG:
FT                   rec:RHECIAT_CH0000550 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54456"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZD0"
FT                   /inference="protein motif:PFAM:PF05239"
FT                   /protein_id="ACS54456.1"
FT                   /translation="MLNQDTDATRRDPNAKVTHSLIASDRVEGTRVYGADGRHIGSIER
FT                   LIIGKLDGRVAYAVLSFGGFLGIGHDHYPLPWEKLNYDTQLDGYRIDLTKEQIEGAPSY
FT                   SDDDDTWYNDNGRRVYDYYGVPPYWM"
     atgttgaacc aggatactga cgccacccgc cgtgacccga atgctaaggt cacgcactcg        60
     ctgatcgcca gcgaccgcgt ggaaggcacc cgtgtctatg gggcagatgg caggcatatc       120
     ggctcgatcg aacgcctgat catcggaaag ctcgacggcc gtgttgccta tgcggtgctg       180
     agcttcggcg gcttcctggg catcggtcat gatcactatc cgcttccttg ggaaaagctg       240
     aactacgaca cccagctgga tggctatcgc atcgacctga ccaaggagca gatcgaaggc       300
     gccccgagct attcggacga tgacgacacc tggtacaacg acaatggccg ccgggtctat       360
     gattactacg gcgtgccgcc ctactggatg taa                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page