(data stored in ACNUC7421 zone)

EMBL: CP001622.PE145

CP001622.PE145       Location/Qualifiers
FT   CDS_pept        complement(141530..143983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0146"
FT                   /product="glycoside hydrolase family 2 sugar binding"
FT                   /note="PFAM: glycoside hydrolase family 2 sugar binding;
FT                   KEGG: rec:RHECIAT_CH0000551 beta-mannosidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54457"
FT                   /db_xref="GOA:C6AZD1"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZD1"
FT                   /inference="protein motif:PFAM:PF02837"
FT                   /protein_id="ACS54457.1"
FT                   /translation="MIEKTALNSGWTLSCNDTVRLGLPAAIPATVPGCVHLDLLANRLI
FT                   PDPYIDVNEITNDWIGKTDWTYRCSFEAMPDDARVQELVFDGLDTVAVISLNGEEIGCT
FT                   FNMHRTYRFDVSRLLKAGQNELTVTFRSAYAYGAEMEKHYGYRPNNYPGPGNLMRKMAC
FT                   NFGWDWGPTLVTAGLWKPVRLESWDRARLAETRVSAILSGGDGLVKVHARLARHGDKTP
FT                   LRLVAEIGGVSKTVAIAPDEDAVSFELALPSPQLWWPHHLGAQPLYPMTLRLFDEASDD
FT                   LLDSYQRELGFRSLRLDTAADDHGSAFTFIINDVPLFICGANWIPDDCFPPRLTAERYA
FT                   ARIEEAKAANIHMLRVWGGGIFEADEFYETCDRKGMLVWQDFLFACAAYPEEEPLRSEV
FT                   EAEVRDNVVRLMPHASLVLWNGNNENIWGFDEWGWRPIIKAGESWGLGYYLDLLPKLCA
FT                   ELDPDRPYYPGSPYSGSMEIEPNANGHGCKHIWDVWNDVGYEVYRNYIPRFCSEFGWQA
FT                   PAAWATIEESVHDAPLTPQSNGVFHHQKATEGNDKLIRGLSGHLPEPKTMDDWHFATQL
FT                   NQARAIRFGVEHMRSHRNICKGSVVWQFNDCWPVTSWAALDSAGRRKPLWYALKTAYDP
FT                   RLLTIQPRGGGLAAVAVNERTLFWRAKISGKRLKLDGTVLAEFEFWRLLCDRFEAKEFP
FT                   LPEEIVTPDLPKDEVIVVQMLDRRAFHYFVEDIELALPAPRLTVDVTSIEGGYGVKVTA
FT                   QNFLKDLCLMADRLDPDAVVDSMLVTLLPGESHVFVVKTTKAIGADDIVFGTVLRSAND
FT                   LTAGR"
     atgatcgaaa agactgcgct caattccggc tggacgctct cctgtaacga tacagtaagg        60
     ctcggcctgc cggctgcaat acccgcgacg gtgccgggct gcgtgcatct cgaccttctc       120
     gccaaccggc tgatccccga tccctatatc gacgtcaacg agatcaccaa tgactggatc       180
     ggcaagaccg actggaccta tcgctgcagt ttcgaggcga tgcctgacga tgccagggtg       240
     caggaactgg tcttcgacgg gctcgatacg gtcgcggtga tatccctcaa cggcgaagag       300
     atcggctgca ccttcaacat gcaccgtacc tatcgtttcg atgtttcccg gcttctgaag       360
     gctggccaga acgaactcac ggtcaccttc cgctccgcct acgcctatgg agcggagatg       420
     gaaaaacatt acggctaccg tcccaacaac tacccgggac cgggcaatct gatgcgcaag       480
     atggcctgta atttcggctg ggactggggg ccgacgctgg tgacggcagg cctctggaag       540
     ccggtccggc tggaaagttg ggatcgggcg cggcttgccg aaacacgggt atcggcaata       600
     ctttccggcg gcgacggcct ggtgaaggtc catgcccggc tggcgcggca tggagataag       660
     acgccgttga ggctcgttgc cgaaatcggc ggcgtgagca agacggtggc gattgcgcct       720
     gatgaagacg cggtttcctt cgagcttgcc ctcccctcgc cgcagctctg gtggccgcac       780
     catctcggcg cgcagccgct ctatccaatg acgctgaggc tgttcgacga ggccagcgac       840
     gatctgctcg acagctatca gcgtgaactc ggtttccgct cgctgcggct cgataccgca       900
     gccgacgacc atggctcggc ctttaccttc atcatcaacg acgtgccgct cttcatctgc       960
     ggggcaaact ggattccgga cgattgtttt cccccgcggt tgacggccga gcgttatgcc      1020
     gcgcggatcg aggaagcaaa ggccgccaat attcatatgc tgcgcgtctg gggcggcggc      1080
     atcttcgagg ccgacgagtt ctatgagacc tgcgaccgca agggcatgct ggtctggcag      1140
     gatttcctct ttgcctgcgc cgcctatccg gaggaagagc cgctcagaag cgaggtcgag      1200
     gcggaggtgc gcgacaatgt cgtgcggctg atgccgcatg cttcgctcgt cctctggaac      1260
     ggcaacaacg agaacatctg gggcttcgac gaatggggct ggcggccgat catcaaggcg      1320
     ggcgaaagct gggggctcgg ctactatctc gacctgctgc cgaaactctg cgccgaactc      1380
     gatccggacc ggccctatta tcccggcagt ccctattccg gctcgatgga gatcgaaccc      1440
     aatgccaacg gtcatggctg caaacatatc tgggatgtgt ggaacgatgt cggctacgag      1500
     gtctaccgca attatatccc gcgcttctgc tccgaattcg gctggcaggc accggctgcc      1560
     tgggcgacga tcgaagaaag cgtgcatgat gcgccgctga cgccgcaatc gaacggcgtc      1620
     ttccaccatc agaaggcaac ggagggcaat gacaagctga tccgcggcct gtccggccat      1680
     ctgccggagc ccaagacgat ggatgactgg catttcgcca cccagctcaa ccaggcgcgt      1740
     gccatccgtt tcggcgtcga gcacatgcgc tcgcatcgca atatctgcaa gggttcggtg      1800
     gtctggcagt tcaacgattg ctggccggtg acctcatggg cagccctcga ttcggccgga      1860
     cgccgcaagc cgctctggta tgcgctgaag acagcctatg atccgcgcct gctgacgatc      1920
     cagccgcgcg gcggcggact tgcggcggtg gccgtcaatg aacggacgct gttctggcgg      1980
     gcgaagatca gcggcaaacg cctgaagctc gacggcacgg tgcttgccga attcgaattc      2040
     tggcgcttgc tctgcgaccg tttcgaagca aaggaatttc cgctgcccga ggagatcgtc      2100
     acccccgact taccgaagga cgaggtcatc gtcgtgcaga tgctggacag gcgagccttc      2160
     cactatttcg tcgaggatat cgagcttgcc ttaccagcac cgcggctgac ggtcgatgtc      2220
     accagcatcg agggcgggta cggggtcaag gtgacggcgc aaaacttcct caaggatctc      2280
     tgcctgatgg ccgatcgact ggatccggat gccgttgtcg attcgatgct ggtgacgctg      2340
     ctgccgggcg agagccatgt gtttgtggtc aagacgacaa aggcgatcgg ggcagacgac      2400
     attgtcttcg gcaccgttct gcggtcggcc aacgatctca ccgccgggcg ctag            2454
//

If you have problems or comments...

PBIL Back to PBIL home page