(data stored in ACNUC7421 zone)

EMBL: CP001622.PE146

CP001622.PE146       Location/Qualifiers
FT   CDS_pept        complement(144065..144460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0147"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: ret:RHE_CH00481
FT                   lactoylglutathione lyase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54458"
FT                   /db_xref="GOA:C6AZD2"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZD2"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACS54458.1"
FT                   /translation="MAKMIHSMIRVLDEARSVEFYERAFGLSVADRVDFETFTLIYISN
FT                   AETGFELELTVNKGRTAPYDLGNAYGHLAVSVEEVAVERERLSKLGLKPGELVELNRDG
FT                   KLFGLFFFISDPDGYKIEVLQRHGRFL"
     ttggcgaaga tgatccactc catgatccgc gttctcgatg aggcgcgctc cgtcgaattc        60
     tacgagaggg ccttcggcct ttcggtcgcc gaccgcgtcg atttcgagac cttcacgctg       120
     atctatatta gcaatgccga gaccggcttc gagctggaac tgacggtcaa caagggccgg       180
     accgcgccct atgacctcgg caatgcctat ggccatctcg ccgtctccgt cgaagaggtg       240
     gcggtcgagc gcgagcggct gtcgaagctc gggctcaagc ccggtgaatt ggtagagctc       300
     aaccgcgacg gcaagctctt cggtctgttc ttcttcatca gcgatccgga tggctacaag       360
     atcgaggtgc tgcagcgcca cggccggttt ctctga                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page