(data stored in ACNUC7421 zone)

EMBL: CP001622.PE147

CP001622.PE147       Location/Qualifiers
FT   CDS_pept        complement(144509..145258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0148"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rec:RHECIAT_CH0000553
FT                   probable proline/glycine betaine ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54459"
FT                   /db_xref="GOA:C6AZD3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZD3"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS54459.1"
FT                   /translation="MKLVVANLFRLAALALLLILLFRTEWLSFMLVPLTSNNAPAVYRQ
FT                   NSLASLAAGHLQLVIGSIVCSAVLAVVGGIFVTRESGADFLPLSRAIANAGQTFPPVAV
FT                   LALAVPATGFGAMPTLIALFLYGLLPIFENTVAGLKQVSPQVLDAADGMGMNGTQRLLR
FT                   VELPLALPLILEGLKVATVINIGTATIGSTVAAKGLGEVIIAGLISDNTAFILQGGLIV
FT                   GLMAVLIYDAMGLIEGAITRRIGLRAA"
     atgaagctcg tcgtcgccaa tctcttccgc ctggcggcgc tggctttgct gctcatcctg        60
     ctgttcagga cggagtggct ttccttcatg ctggtgccgc tgaccagcaa caatgcgcct       120
     gccgtctata ggcagaacag ccttgcttcg ctggccgccg gccatctgca gctggtgatc       180
     ggatcgatcg tctgcagcgc cgtgctcgcc gttgtcggcg gcatcttcgt gacacgggaa       240
     agcggggctg acttcctgcc gctgtcgcgc gcaatcgcca atgcggggca gacttttccg       300
     ccggtcgccg tgctggcgct cgccgttccc gcgaccggct tcggcgccat gccgacgctg       360
     atcgcgctct ttctctacgg gctgctgccg atcttcgaaa acactgttgc cggcttgaag       420
     caggtttcgc cgcaggttct cgatgccgcc gacggcatgg gcatgaacgg cacgcagcgg       480
     ctgctgcggg tcgagctccc gcttgccttg ccgctgatcc tcgaagggct gaaggtcgcg       540
     accgtgatca atatcggcac ggcgacgatc ggctcgacgg ttgcggccaa gggcctcggc       600
     gaggtcatca tcgcagggct gatttccgac aacaccgcct tcatcctgca gggcggcctg       660
     atcgtcggcc tgatggcggt gctgatctat gacgccatgg gcttgatcga aggagcgatt       720
     acgcgaagaa tcggcttgcg cgcggcgtag                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page