(data stored in ACNUC7421 zone)

EMBL: CP001622.PE148

CP001622.PE148       Location/Qualifiers
FT   CDS_pept        complement(145255..146199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0149"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rec:RHECIAT_CH0000554 probable proline/glycine
FT                   betaine ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54460"
FT                   /db_xref="GOA:C6AZD4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZD4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS54460.1"
FT                   /translation="MTMIEIRNVTKRYGAATVVDDVSMSVEKGEITVIVGTSGSGKSTL
FT                   MRMINRLVPITEGEIFVGGQNVMDVPVTELRRKIGYAIQGHGLFPHRTVAQNIATVPQL
FT                   LDWDSARIAKRVEELLGLFNLDPATFADKYPHQLSGGQQQRVGVARALAAEPELLLMDE
FT                   PFGALDPVIRGKAQDDLLAIQKQFGTTVILVTHDMDEAFHLGNQIAVMSEGRLLQCSTP
FT                   EKILTEPADPFVQQLTGTSDRALKLMSLLPLKESMEPAKNGLAYALPQSLSLRDALAEM
FT                   IWQGVDEAAVQDGEKAPVGSISMTRLLELGRKA"
     atgaccatga tcgagatcag gaacgtcacc aagcgctatg gcgcggccac cgtcgtcgac        60
     gacgtctcga tgagtgtcga gaagggcgag attaccgtca tcgtcggcac gtctggctcc       120
     ggcaaatcga cgctgatgcg gatgatcaac cggctggtgc cgatcaccga aggcgagatc       180
     ttcgtcggcg gacagaatgt gatggacgtt ccggtgaccg agcttcgccg caagatcggc       240
     tatgcgatcc aggggcacgg cctctttccg caccggaccg tggcgcagaa tatcgccacc       300
     gtgccgcagc ttctcgattg ggattccgcc cgcatcgcca aacgcgtcga ggaactgctt       360
     gggctcttca acctcgatcc agcaaccttt gccgacaaat atcctcacca gctctccggc       420
     ggccagcagc agcgcgtcgg tgtcgcccgg gcgctggcgg ccgagccgga actgctgttg       480
     atggacgagc cgttcggcgc gctcgatccc gtcatccgcg gcaaggcgca ggacgatctg       540
     ctggcgatcc agaagcagtt tggcacgacg gtcattctcg tcacccacga catggacgag       600
     gccttccatc ttggcaacca gattgcggtg atgagcgagg gcagattgct gcaatgctcg       660
     acgccggaaa agatcctcac cgaacccgcc gatcccttcg tgcagcaatt gaccggcacc       720
     tccgaccggg cgctgaagct gatgtcgctg ctgccgctga aggaaagcat ggagccggcc       780
     aagaacggtc tcgcctatgc cctgccgcag tcgctcagcc tgcgtgatgc gctggccgag       840
     atgatctggc agggggtcga tgaggcggcc gtgcaggacg gcgaaaaggc gcctgtggga       900
     tcgatctcga tgacgcggct gctcgaactg ggccgtaagg catga                       945
//

If you have problems or comments...

PBIL Back to PBIL home page