(data stored in ACNUC7421 zone)

EMBL: CP001622.PE149

CP001622.PE149       Location/Qualifiers
FT   CDS_pept        complement(146196..147362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0150"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rec:RHECIAT_CH0000555
FT                   probable proline/glycine betaine ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54461"
FT                   /db_xref="GOA:C6AZD5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZD5"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS54461.1"
FT                   /translation="MAETLAVRRLDRLGVVLVAGGIAATALMPFIYVKANRIAAGKPML
FT                   LLQLLPQPSVVILTVLLLLTAFATLFLRHAIARLAIATLCLAALIVAIGLVSAAATPPG
FT                   STVARMTPGGGFWVLFAVIGLVISDALVKIRLAPWMRIAALAAYTALLFISLSSGLLDS
FT                   LSIMKEFSTRAPQFETEAISHLLLAFGSLAIAVVLGLPLGILCFWVPKLRAIVLQGLSL
FT                   IQTIPSLALFGLLMLPLGYLATHVPLAAAIGIRGIGTAPALIALVLYSLLPIVANTVVG
FT                   LQGVDPSVRDAAAGMGLTRWQILVGIDMPLAFPVILTGIRIVLVQAIGMVTIAALIGGG
FT                   GFGIFIFQGLGQTAMDLVLLGAVPTVFFAFSSAVILDAVIESIRGSAA"
     atggcagaaa ccttagcggt ccgcaggctg gaccggctcg gcgtggttct ggtggccggc        60
     ggcatcgcgg cgacggcact gatgcccttc atctacgtga aggcaaatcg catcgccgcc       120
     ggcaagccga tgctgctgtt gcagcttctt ccccagcctt ccgtcgtcat cctgaccgtg       180
     ctcctccttc tcaccgcctt cgccacgctg ttcctacgcc atgcgatcgc gcggcttgcg       240
     attgcgacac tctgtcttgc ggcgctgatc gttgcgatcg gcctcgtctc ggccgcggca       300
     acgccgcccg gcagcacggt ggcgcggatg acgcccggcg gcggcttctg ggtgctgttt       360
     gccgtgatcg ggctcgtcat atccgatgcg ctggtgaaga tccgccttgc gccctggatg       420
     cggatcgcag cccttgcagc ctatacggcg ctgctcttca tctcgctctc ctccggcctg       480
     ctcgacagcc tttcgatcat gaaggaattt tcgacacggg caccgcagtt cgaaaccgaa       540
     gcgatctcgc atctgctgct cgcgttcggc tcgcttgcca tcgccgttgt tctcggcctg       600
     ccgctcggca tcctctgctt ctgggtgccg aagctgcggg ccatcgtgct gcaggggctg       660
     agcctcatcc agacgatccc gagtctggca ctcttcggcc tgttgatgct gccgctcggc       720
     tatctcgcca cccatgtgcc gctcgccgcc gcaatcggca ttcgcggcat cggcacggcg       780
     cccgccttga ttgcgctggt gctctattcg ctgctgccga tcgtcgccaa caccgtcgtc       840
     ggccttcagg gcgtcgaccc ctcggtacgc gacgctgcgg ccggcatggg gctgacacgg       900
     tggcagatcc ttgttggaat cgacatgccg ctcgcctttc ccgtgatcct caccggcatc       960
     cgcatcgtgc tggtgcaggc gatcggcatg gtgacgatcg ccgcgctgat cggcggcggc      1020
     ggcttcggca tcttcatctt ccaggggctc ggccagacgg ccatggacct cgtcctgctc      1080
     ggcgccgtgc cgaccgtctt cttcgccttc tcatcggccg tcatcctcga tgcggtcatc      1140
     gaaagcatcc ggggatctgc cgcatga                                          1167
//

If you have problems or comments...

PBIL Back to PBIL home page