(data stored in ACNUC7421 zone)

EMBL: CP001622.PE15

CP001622.PE15        Location/Qualifiers
FT   CDS_pept        complement(11954..13192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0015"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /note="KEGG: ret:RHE_CH00370 S-adenosylmethionine
FT                   synthetase; TIGRFAM: S-adenosylmethionine synthetase; PFAM:
FT                   S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54327"
FT                   /db_xref="GOA:C6AYA3"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYA3"
FT                   /inference="protein motif:TFAM:TIGR01034"
FT                   /protein_id="ACS54327.1"
FT                   /translation="MRANYLFTSESVAEGHPDKVCDRISDEIVDLVYREAAKTGVNPWG
FT                   VRIACETLATTNRVVIAGEVRLPPSLMKKDKDGKDVINPSKFKAAARRAIKDIGYEQDG
FT                   FHWKKAKIDVLLHSQSADIAQGVDSAADQQGDEGAGDQGIMFGYACRETPDLMPAPIYY
FT                   SHKILQLLAVARKKGDGEVAKLGPDAKSQVTVRYVDGKPSEATSIVLSTQHLDESWVSK
FT                   KVRAVVEPYIREALGGLKIADDCKWYINPTGKFVIGGPDGDAGLTGRKIIVDTYGGAAP
FT                   HGGGAFSGKDTTKVDRSAAYAARYLAKNVVAAGLADRCTIQISYAIGVAQPLSIYVDLH
FT                   GTGKVTEDQIEAAIRKNMDLSPTGIRRHLDLNKPIYAKTSAYGHFGRKAGRDGSFSWER
FT                   TDLVKALKESVKT"
     atgcgcgcga attatctctt taccagcgaa tctgttgccg aaggtcatcc ggacaaggtc        60
     tgtgaccgta tctccgacga gatcgtcgat ctggtctacc gcgaagcggc caagaccggc       120
     gtcaacccat ggggcgtgcg cattgcctgc gagacgctgg cgacgaccaa ccgcgtcgtc       180
     atcgccggtg aggtccgcct gccgccgagc ctgatgaaga aggacaagga tggcaaggac       240
     gtcatcaatc cttcgaagtt caaggccgcc gcccgccgcg ccatcaagga tatcggctac       300
     gagcaggacg gcttccactg gaagaaggcg aagatcgacg tgctcctgca ctcgcagtcg       360
     gccgacatcg cgcagggcgt cgatagcgcc gccgaccagc agggcgacga gggcgccggc       420
     gaccagggca tcatgttcgg ttacgcctgc cgcgaaacgc cggacctgat gccagccccg       480
     atctattatt cccacaagat cctgcagctg ctcgcagttg cccgcaagaa gggcgacggc       540
     gaagtcgcca agctcggccc cgacgccaag agccaggtga ccgtgcgtta cgtcgacggc       600
     aagccgtcgg aagcaacctc gatcgtgctt tcgacccagc atctcgacga gagctgggtt       660
     tcgaagaagg ttcgcgccgt tgttgagccc tatatccgcg aagcgctcgg cggactgaag       720
     atcgccgacg attgcaagtg gtatatcaac ccgaccggca agttcgtcat cggcggaccg       780
     gacggcgatg cgggcctcac cggccgcaag atcatcgtcg acacctacgg cggtgccgct       840
     ccgcatggcg gcggcgcatt ctccggcaag gacacgacga aggtcgaccg ttcggccgcc       900
     tatgccgccc gctaccttgc caagaacgtc gtcgccgccg gccttgccga ccgttgcacg       960
     atccagattt cctacgcgat cggcgtcgcc cagccgctgt cgatctatgt cgacctgcac      1020
     ggcaccggca aggtcaccga ggatcagatc gaagcggcta tccgcaagaa catggacctt      1080
     tcgccgaccg gtatccgccg ccatctcgac ctcaacaagc cgatctatgc caagacctcc      1140
     gcctatggcc atttcggccg caaggccggc cgcgacggct cgttctcctg ggagcgcacc      1200
     gacctcgtga aggcgctcaa ggaaagcgtg aagacctga                             1239
//

If you have problems or comments...

PBIL Back to PBIL home page