(data stored in ACNUC7421 zone)

EMBL: CP001622.PE150

CP001622.PE150       Location/Qualifiers
FT   CDS_pept        complement(147453..148361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0151"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system; KEGG: ret:RHE_CH00485 glycine
FT                   betaine ABC transporter, substrate binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54462"
FT                   /db_xref="GOA:C6AZD6"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZD6"
FT                   /inference="protein motif:PFAM:PF04069"
FT                   /protein_id="ACS54462.1"
FT                   /translation="MLKKLALAVSLSAFAVGAAHAADVVVSSKIDTEGTLLGNVIALAL
FT                   EANGIKTQDRIALGATPVVRKAITAGEIDIYPEYTGNAGFFFNKADDAAWKNIDQGYEL
FT                   AKKLDYDANKIVWLTPSPANNTWALAVRSDVAGPNKLKSLTDFGKWVAGGGAAKLAASA
FT                   EFVNSAGALPAFQTTYGFQLKPDQMVVLSGGDTAATIKAAADQTNGVNTAMVYGTDGAI
FT                   EAAELTVLEDDKNVQQVYAPTPIIREEVLKANPKIEEVLSPIFKSLTADELRKLNAKIQ
FT                   VDGEPAKSVAEAYLKEKGFLK"
     atgctgaaga aactcgcact tgccgtttcg ctctccgcct tcgcggtggg tgcggcccat        60
     gccgccgacg tcgtcgtctc gtcgaagatc gacacggaag gcacgctgct cggcaacgtc       120
     atcgcgctcg ctctcgaagc caacggcatc aagacgcagg accgcatcgc gcttggcgcg       180
     acaccggtcg tgcgcaaggc gatcaccgca ggcgaaatcg acatctatcc cgaatatacc       240
     ggcaacgccg gcttcttctt caacaaggcc gatgacgccg cctggaagaa catcgaccag       300
     ggctatgagc tggcgaagaa gctcgattac gatgccaaca agatcgtctg gctgacgccg       360
     tcgcctgcca acaacacctg ggcgctcgcc gtgcgcagcg atgttgccgg cccgaacaag       420
     ctgaagagcc tcaccgactt cggcaaatgg gttgccggcg gcggtgccgc caagcttgcc       480
     gcctccgccg aattcgtcaa ttcggccggc gcgcttcccg ccttccagac gacctacggc       540
     ttccagctga agcccgacca gatggtcgtt ctttccggcg gcgacacggc ggcaacgatc       600
     aaggcagccg ccgaccagac gaacggcgtc aacaccgcca tggtctacgg caccgacggc       660
     gcgatcgaag cggctgaact caccgttctc gaagacgaca agaacgtgca gcaggtctac       720
     gccccgacgc cgatcattcg cgaagaggtg ttgaaggcca atccgaaaat cgaggaagtg       780
     ctctcgccga tcttcaagag cctgaccgcc gacgaattgc gcaagctcaa cgccaagatc       840
     caggtcgatg gcgagccggc aaaatccgtc gccgaagcct atctcaagga aaagggcttc       900
     ctgaagtag                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page