(data stored in ACNUC7421 zone)

EMBL: CP001622.PE151

CP001622.PE151       Location/Qualifiers
FT   CDS_pept        148783..150003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0152"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: rec:RHECIAT_CH0000558 probable transcriptional
FT                   regulator protein, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54463"
FT                   /db_xref="GOA:C6AZD7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZD7"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACS54463.1"
FT                   /translation="MHLGALFIASHVLTSGSVRETARRFHLSPSTVSTAIHNLETELAM
FT                   TLTERASGELAMLIASGRVLEGLKPIMAAIGELGQWAGHDGDGAEIDEVWASRIPVKIV
FT                   TMERFLEVADQGSINRAARRLRLGQPQLSLQLANLEKFLTHRLFERQAQGSVLTEEGRR
FT                   AYQIFMAISQAWNDLKSSADERYRRTARSLRIGSIIPTGSESWVARCLGSLVSEWNARR
FT                   NNNAISLVSMTADDLREALKNGRIDVAILDSVFGLESFRHRELLQTDMVVIAPPDSTET
FT                   SVADLVAGHPICMPSPRTGLGHAAMAFSYERAPNRRRRGQDITAADSLPVIVDLVANHG
FT                   YVSFLGRVSAMPIADKVRIVDLDEHLPMSYHVAFNHRKAAADACTMIIEAAARITSEAV
FT                   VRTAAVA"
     ttgcatcttg gtgccctgtt catcgccagc catgtcctga cctccggttc ggtccgcgag        60
     accgcgcggc gcttccacct atcgccctcc accgtctcga cggcaatcca taatctcgag       120
     accgaactgg cgatgacgct gaccgaacgc gcctccggcg agctggcgat gctaattgcg       180
     agcggcaggg tgctggaagg cctgaagccg atcatggctg cgatcggtga gctcggccaa       240
     tgggccggtc acgacggcga cggcgctgag atcgacgagg tctgggcatc gcgcattccc       300
     gtcaagatcg tcacgatgga gcggtttctc gaagttgccg accaggggag catcaaccgg       360
     gcagcgcgcc gccttcgcct cggtcagccg cagctttcac ttcagcttgc caatcttgag       420
     aaatttctga cccatcgcct gttcgagcgc caggcgcagg gctcggtgct gacggaggag       480
     ggcaggcgcg cctaccagat cttcatggcg atcagccagg cgtggaacga tctgaaatcg       540
     tcggccgacg agcgttatcg gcgcactgcc cggtcgctgc gcatcggttc gatcatcccg       600
     accggatcgg aaagctgggt ggcgcgctgc ctgggatcgc tggtctccga atggaatgcg       660
     cgccgcaaca acaatgcgat ctcgctggtg tcgatgaccg ccgacgatct gcgcgaggcg       720
     ttgaagaacg gccgcatcga tgtcgcaatc ctggattcgg tcttcggcct cgaaagcttt       780
     cggcatcgcg aactgctgca gaccgatatg gtggtgatcg cgccgccgga tagtaccgag       840
     accagcgttg ctgatctcgt cgccggccac ccgatctgca tgccgagccc gcgcaccggc       900
     ctcggccatg cggccatggc cttcagctac gagcgcgcgc ccaaccggcg ccggcgcggc       960
     caagatatca ccgcggcgga ttcgctgcct gtcatcgtcg acctcgtcgc caatcacggc      1020
     tacgtctcct tcctcggtcg ggtcagcgcc atgccgattg ccgacaaggt gcgcatcgtc      1080
     gatctcgacg agcacctgcc gatgtcctat cacgtcgcct tcaaccatcg aaaagccgcc      1140
     gccgatgcct gcacaatgat catcgaggcg gcagcgagaa ttacctctga agcggtcgtg      1200
     cgaaccgcag ccgtggctta a                                                1221
//

If you have problems or comments...

PBIL Back to PBIL home page